CAZyme Information: ETI19587.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI19587.1
• CAZy Family: AA1
• CAZyme Description: GH16 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:V9D0T5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
341		35121.12	4.1044

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822710:950107-951182(-)

Full Sequence      

MHTSVASSVLAALALSSLLVPTVAQTYSSCNPLQQSGCPADPALGRSVDVEFAAGASDEF
TASGAVSYTSDGAAFTISQRGDAPTLSSNWYIMFGHVDFVVKAAPGTGIVSAAILQSDCL
DEIDWEWLGGDNSQAQSNYFGKGITTTGYNRGAYHGAPNNHDEFHTYSIDWTADQIVWSI
DGQTVRAMTQSQAEAGQYPQTPMYVKLGAWAGGDPSNPEGTIQWAGGVTDYSAGPFTMYV
KSIHVTDYSTGSQYSYSGTSGTWQSISSNGGQINGQGNGVPVSSGSVPAVTSSVPNSAPL
AFGNGDDGSSATATRTGWPWSGTATATVASVVSSSTSGLTS

Enzyme Prediction     

No EC number prediction in ETI19587.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	71	227	5.2e-70	0.9873417721518988

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185692	GH16_fungal_CRH1_transglycosylase	5.74e-108	50	249	1	203	glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
395585	Glyco_hydro_16	1.05e-52	64	226	4	168	Glycosyl hydrolases family 16.
185683	Glyco_hydrolase_16	2.64e-21	87	246	60	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185684	GH16_lichenase	1.95e-15	63	243	31	208	lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure.
185693	GH16_laminarinase_like	1.18e-13	122	245	115	234	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK45888.1|GH16_18	2.80e-127	1	294	1	290
BCS15922.1|GH16_18	1.08e-125	1	294	1	290
BCS04334.1|GH16_18	1.08e-125	1	294	1	290
BCS24002.1|GH16_18	1.06e-123	11	302	9	298
EAA59223.1|GH16_18	1.97e-123	17	302	14	297

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6IBU_A	4.35e-87	27	266	1	242	Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBU_B Apo Crh5 transglycosylase [Aspergillus fumigatus Af293],6IBW_A Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293],6IBW_B Crh5 transglycosylase in complex with NAG [Aspergillus fumigatus Af293]
3D6E_A	7.17e-12	94	241	59	200	Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis],3D6E_B Crystal structure of the engineered 1,3-1,4-beta-glucanase protein from Bacillus licheniformis [Bacillus licheniformis]
5SV8_A	6.90e-11	121	245	88	201	Crystal Structure of the catalytic nucleophile and surface cysteine mutant of VvEG16 in complex with a xyloglucan oligosaccharide [Vitis vinifera]
1GBG_A	7.52e-11	94	241	72	213	Bacillus Licheniformis Beta-Glucanase [Bacillus licheniformis]
1CPM_A	1.88e-10	94	274	14	187	NATIVE-LIKE IN VIVO FOLDING OF A CIRCULARLY PERMUTED JELLYROLL PROTEIN SHOWN BY CRYSTAL STRUCTURE ANALYSIS [Paenibacillus macerans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4ALQ5|CRH11_ARTBC	1.45e-97	1	299	1	284	Probable extracellular glycosidase ARB_05253 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05253 PE=1 SV=2
sp|Q8J0P4|CRF1_ASPFU	6.93e-87	12	266	7	263	Probable glycosidase crf1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=crf1 PE=1 SV=2
sp|P53301|CRH1_YEAST	1.00e-83	28	276	38	285	Probable glycosidase CRH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CRH1 PE=1 SV=1
sp|Q5AFA2|CRH11_CANAL	3.16e-78	29	276	23	270	Extracellular glycosidase CRH11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CRH11 PE=1 SV=1
sp|D4B4J2|CRH12_ARTBC	3.65e-70	8	266	8	269	Probable extracellular glycosidase ARB_03382 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_03382 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999818	CS pos: 24-25. Pr: 0.9764

TMHMM  Annotations     

There is no transmembrane helices in ETI19587.1.