CAZyme Information: ETI19243.1

Basic Information

• Species: Cladophialophora carrionii
• Lineage: Ascomycota; Eurotiomycetes; ; Herpotrichiellaceae; Cladophialophora; Cladophialophora carrionii
• CAZyme ID: ETI19243.1
• CAZy Family: AA1
• CAZyme Description: Glyco_trans_2-like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:V9CYX0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
864		97932.39	5.5319

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_CcarrioniiCBS160.54	10428	1279043	55	10373

• Gene Location: location=KB822710:5015-7907(-)

Full Sequence      

MAYHNDDFDFDAPQFPTRSPSQMSFASHADSMAPLGSAGAFKCDIMVKFLRQRQMEKLWS
NSVDGEGVILKRGKNDFVCQPSELLFENNGLFHQVCQLNVKVAMTVKTDVIETFLRTSQL
PYVPYVDGLRIQVLPDISFLSTGKKHHFAAFIQNPGYLVVWHDDPEQVINRAEKIEQHLV
SLLWKDENLVIPKSENASAAPSIREKADNADVEDARRFDDSPRRTILYQAVLMGLAGLLV
ILTIGVGWRKVAIEVKTDSTYVRLALAAVILPQIWLGWFFFQTLVNGISQLFGPVNQLDS
NSRTFSGIRSKRLETDTLPHVTVQCPVYKEGLWSVIDPTMVSIREAISTYEMQGGTVNIF
VNDDGMQLIKDNEAKERREYYEEHNIGWVARPKHNPNPKPDSGERAFTRAGKFKKASNMN
YAMNVSARVEDRLAAIPRHDAWTQQDEDEVYQRILQQIIEEDEGRTWAQGDVRIGDYILI
IDSDTRVPADCFLDMVSEMEASPQVAIIQFSSGVMNVTTSFFEKGITFFTNLVYTAIQFA
VANGDIAPFVGHNAVLRWSALQDIAYEEDGVEKYWAETTVSEDFDMALRLQSKGYDLRFS
TYFGSEGFQEGVSLTVYDELARWEKYAYGCSELIFNPLIYWPTRGPVTPLFRKFITSNMS
VMAKITIMSYIGTYYAIGSAWVLTALNYFLIGWFNGYLDHYYTDSFKIYFSIVVVFQALG
TVSLAVLRYRVAGRSLIGAFLENLTWLPLLTIFLGGISIHVSQAIACHMLSINMTWGATA
KEATRTSFFEEVPTILRRFKFTFLFCFLMVFGMIVLAGVGPLGHLVPHDWQIKDFTAIWP
MALVVAFHFLLPLVLNPGLMQFTF

Enzyme Prediction     

No EC number prediction in ETI19243.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	477	693	1.2e-51	0.9796954314720813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404513	Glyco_trans_2_3	2.33e-46	477	694	1	192	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	6.60e-13	475	761	138	411	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133045	CESA_like	7.96e-12	326	583	4	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
133043	CESA_CelA_like	2.99e-10	319	599	1	202	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133034	Glucan_BSP_MdoH	3.66e-08	476	622	97	243	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
USW53192.1|GT0	0.0	42	863	72	887
UJO15800.1|GT0	0.0	27	864	64	888
SMY19115.1|GT0	0.0	42	864	69	883
SMQ45410.1|GT0	0.0	42	864	69	883
SMR43958.1|GT0	0.0	42	864	69	900

PDB Hits     

ETI19243.1 has no PDB hit.

Swiss-Prot Hits     

ETI19243.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000060	0.000000

TMHMM  Annotations     

Start	End
226	248
260	282
672	694
707	729
744	766
801	823
838	860