CAZyme Information: EQL35407.1

Basic Information

• Species: Blastomyces dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces dermatitidis
• CAZyme ID: EQL35407.1
• CAZy Family: GH92
• CAZyme Description: murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
853		92558.48	7.2866

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BdermatitidisATCC26199	9560	447095	380	9180

• Gene Location: location=GL538376:211151-213934(+)

Full Sequence      

MICLDQENGGVNSLFDEIYIRQFPSSMGMAATGSKSLVREVSKATAQELSAVGVNWILGP
VLDALTNARNQPLGVRSVGDDPQEVSAYGIEFMKGYQDAGLVTCGKHFPSYGNLDYMGSQ
SDVPIITDTIEQLSVSALVPYRNAITHGIDSMMVGGCSMTAGGMTVMHACLSEQVVDELL
RKDLKFEGVVVSECLEMGALSHNIGVGGGTVMAMKAGCDLILLCRTFSVQQEAINGLKLG
VENGIISKSRIRESLRRVLDMKSRCTSWEKALNPQGLSLLSKMQPSHTSLSTKAYSSSLT
VVRDKHNYLPLSSILEPDEELLLLTPLIKPLPASAMLLSVATESGRAGLSADAASWERSA
SVMSGESVFKEFGRSLSRQRNGRVLHTSYTANGVRPVHENLINRASAVIIVTADANRNLY
QMGFTKHVSLMCNSQFSPNGERRAKPVIVVAVSSPYDFATDLSIGTYICTYDFTETALQA
LVKILYGELNPTGSLPGSLSRNQRLQQSRQHWLVENWNEDRDAHALDTLLDIVREGSAQG
QRSELASVTSTTFLLRNSDVEESHFVVRNSSTQALYGFCSTYYFKSTGTGAVGAIIVDPS
RRRMSIGHSLHNRAIRTLVQRPGIRSFQLGSRLPGIYLGIPKGNPTERKKLRSWFVNLGW
NTALSRSVCSMVLRNLENWSPPEGLTKVLQSSEVDYDLVYGWEYADSVLDHVKTTSRVGV
MEIYKRGLGGAPGSGIIRAKRRDDGTILGTVVVYNSSSALAESMPALKDTRTVAGGISCP
VISPSVGEYATLVQGLILLGIKQIRKQGASAAILDCVDADGNYDSLSSMGFSVLHSFEEV
TCDASTWNIMVTS

Enzyme Prediction     

No EC number prediction in EQL35407.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	2	222	1.8e-49	0.9351851851851852

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	6.57e-57	1	312	63	351	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	4.99e-49	1	259	69	314	Glycosyl hydrolase family 3 N terminal domain.
235417	PRK05337	3.99e-22	46	238	107	294	beta-hexosaminidase; Provisional
185053	PRK15098	2.46e-10	22	262	119	353	beta-glucosidase BglX.
178629	PLN03080	2.82e-08	23	496	114	585	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS62698.1|GH3	0.0	1	853	72	924
QSS50503.1|GH3	0.0	27	853	1	827
QSS74235.1|GH3	0.0	27	853	1	827
CAK47105.1|GH3	0.0	1	850	258	1104
BCS15461.1|GH3	0.0	1	850	82	928

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZM6_A	7.49e-68	2	683	77	700	A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
6K5J_A	9.11e-48	1	500	79	532	Structure of a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	3.71e-33	1	496	119	614	Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	5.41e-33	1	496	93	588	Chain A, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	6.86e-33	1	496	123	618	Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P40406|NAGZ_BACSU	1.91e-32	1	496	119	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
sp|Q7WUL3|NAG3_CELFI	7.61e-31	25	312	107	399	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
sp|Q3SKU2|NAGZ_THIDA	1.88e-21	1	234	60	293	Beta-hexosaminidase OS=Thiobacillus denitrificans (strain ATCC 25259) OX=292415 GN=nagZ PE=3 SV=1
sp|P48823|HEXA_PSEO7	2.38e-20	2	304	102	419	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
sp|Q6LJ30|NAGZ_PHOPR	2.53e-20	1	237	58	287	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000067	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EQL35407.1.