CAZyme Information: EQL29332.1

Basic Information

• Species: Blastomyces dermatitidis
• Lineage: Ascomycota; Eurotiomycetes; ; Ajellomycetaceae; Blastomyces; Blastomyces dermatitidis
• CAZyme ID: EQL29332.1
• CAZy Family: AA7
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:T5B8P0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	GL538489|CGC1	74246.69	9.1394

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_BdermatitidisATCC26199	9560	447095	380	9180

• Gene Location: location=GL538489:101261-103293(-)

Full Sequence      

MRTQRFVVLLAVVCLVGLSFVLLGHPVPAGRVKESGKNNPLFIPTENRPKNVDHQRQQQQ
QQQQQQQQQQQQQQQQQPQQQQQKQNIPHEHPITVTDKSHPVAQLFDNANRKFENVRARQ
SKTLKDAVEEYRRRYKMPPPPRFDAWFNFAQKRGVKLIDEYDTIYHSLLPFWGLEPQLIR
TRAKEVIGFDNGVIAVLIRSGKVSKIAGGGEGIMWKREALKNMLERFVKYLPDMDLAFNI
HDEPRVVVPYDDLQRLVLRAVDNALPKAFANASPRNSWSPRPKDLNKGDRVDEVRITRFN
RFAHQPTWTISRMSCPVDSPARSLDETAADNITAYSYSQLGFIYNTTAFSDVCLTPSLRH
TFGFFDRPNAFDVTHDLFPIFSQSKVSSFQDILYPSPWYWAQKVPYDATMDYEWDNKQEQ
MYWRGSTTGGFSRAGGWRRQHRQLFVKRINGWDTAKVYERSTTAAEDNAWTLKDVARRKF
KHIFNVKFSHIGQCDPEDCKAQAEFFDVVQSAAQQDAWQYKHLVDIDGNAFSGRYYAFLQ
SNSLVYKLAVFREWHDEWLRAWVHYIPLSLHGDEHVETVRYLATEKEGQAIARTLAAQGQ
EWAQSALRNDDLEVYFFRLLLEYGRIVDDNRESIGFSP

Enzyme Prediction     

No EC number prediction in EQL29332.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	356	627	6e-80	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.15e-15	375	625	28	251	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	6.78e-08	379	625	108	321	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSS70518.1|GT90	0.0	1	638	7	624
QSS52524.1|GT90	0.0	1	638	1	618
QSS64625.1|GT90	0.0	1	638	131	743
BCR83603.1|GT90	1.12e-291	97	636	63	598
QGA13289.1|GT90	1.18e-281	96	638	52	590

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	6.80e-08	379	627	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]
5L0R_A	3.18e-07	356	630	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	6.82e-47	99	633	151	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	2.78e-08	379	627	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	6.49e-08	510	627	272	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8T045|RUMI_DROME	3.59e-07	379	627	166	391	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	8.05e-07	379	627	163	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.952042	0.047989

TMHMM  Annotations     

Start	End
7	29