CAZyme Information: EPrPVT00000024814-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000024814-p1
• CAZy Family: PL1
• CAZyme Description: Beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
243		27243.57	4.6227

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC3088:1-729(-)

Full Sequence      

EAYTAAHNVIVSHGSAVKVFRDLKASGVVNESARIGIVLNLDYAYPLDATNPADVAAAER
KMEFEAGWWLAPLVTGDYPPVMRERVGERLPPFYPQQAEVVKGSYDLLMLNHYGSKMVTS
CDSASSNIECDTLHVGFEQDRGTDDSHLVPGTRKRSERASQDPHCAMFTAYPPGYLETIK
WMHAKDPTADILLTENGWCGDDEVENMDQLWYFKAYVEQVHKAVTEEKIPVIGYTAWSFL
DNY

Enzyme Prediction     

EC	3.2.1.21:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	1	243	8.7e-48	0.47086247086247085

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395176	Glyco_hydro_1	4.09e-49	1	243	188	412	Glycosyl hydrolase family 1.
225343	BglB	1.01e-28	1	243	191	414	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215435	PLN02814	6.94e-24	1	243	219	443	beta-glucosidase
215455	PLN02849	9.46e-23	1	243	221	443	beta-glucosidase
215539	PLN02998	5.61e-15	1	243	225	448	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29641.1|GH1	8.90e-123	1	243	201	443
EGZ16993.1|GH1	1.80e-122	1	243	220	462
CCA20215.1|GH1	7.31e-95	3	243	213	452
UIZ29273.1|GH1	1.85e-76	3	237	148	369
VFR16021.1|GH1	5.64e-36	1	243	188	423

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4GXP_A	1.15e-40	1	243	196	425	Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_B Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8],4GXP_C Chimeric Family 1 beta-glucosidase made with non-contiguous SCHEMA [Thermotoga maritima MSB8]
3AHY_A	2.54e-37	1	243	195	430	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]
6EFU_A	1.19e-34	1	243	189	423	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	1.19e-34	1	243	189	423	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	1.50e-34	1	243	208	442	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9FLU8|BGL32_ARATH	1.89e-35	1	243	235	473	Beta-glucosidase 32 OS=Arabidopsis thaliana OX=3702 GN=BGLU32 PE=2 SV=2
sp|Q9FIW4|BGL42_ARATH	1.10e-32	1	243	208	443	Beta-glucosidase 42 OS=Arabidopsis thaliana OX=3702 GN=BGLU42 PE=2 SV=1
sp|Q95X01|MYRO1_BREBR	1.14e-32	3	243	192	422	Myrosinase 1 OS=Brevicoryne brassicae OX=69196 PE=1 SV=1
sp|Q9FLU9|BGL31_ARATH	3.14e-32	1	243	235	473	Beta-glucosidase 31 OS=Arabidopsis thaliana OX=3702 GN=BGLU31 PE=2 SV=1
sp|Q25BW4|BGL1B_PHACH	4.25e-31	1	243	208	436	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000024814-p1.