CAZyme Information: EPrPVT00000024811-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000024811-p1
• CAZy Family: PL1
• CAZyme Description: Glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
231		25982.56	6.1602

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC3081:24-716(-)

Full Sequence      

LFIRDGHFIDQHGRVVLLRGVNLGGSSKLPTGYAHTDEQDFSDFFDGAPHVSFVGRPFPL
KEADLHLSRLRRWGLTFLRFIVTWEAIEHEGPGIYDREYLAYVRSVVEKAAEYDMQVYID
PHQDVWSRWTGGDGAPMWTLESIGLEPRHFAATGAALCVETCGLPASQFPKMIWPTNIGK
LATATMFTLFFGGRKFAPKCHVDGVQIQDYLQDHYLGALEVLAESLRGLPN

Enzyme Prediction     

No EC number prediction in EPrPVT00000024811-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	10	227	5.5e-103	0.40816326530612246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395098	Cellulase	5.54e-05	55	124	20	88	Cellulase (glycosyl hydrolase family 5).
225344	BglC	0.003	73	122	85	137	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27469.1|GH5_12	3.94e-107	1	231	14	246
CCA13966.1|GH5_12	1.40e-100	1	231	51	292
AIG56220.1|GH5_12	3.45e-87	1	231	43	258
AEJ62294.1|GH5_12	6.36e-84	9	231	31	248
QPC82820.1|GH5_12	5.53e-82	8	231	11	229

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LPO_A	8.96e-64	7	226	27	251	Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPO_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPP_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_A Chain A, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_B Chain B, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_C Chain C, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99],7LPQ_D Chain D, Cytoplasmic protein [Cryptococcus neoformans var. grubii H99]
5CCU_A	1.14e-06	5	150	47	164	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5CCU_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]
5J14_A	1.14e-06	5	150	47	164	Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J14_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_A Chain A, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S],5J7Z_B Chain B, Putative secreted endoglycosylceramidase [Rhodococcus hoagii 103S]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|H1AE13|EGCR1_ASPFM	1.31e-70	5	226	9	228	Glucosylceramidase OS=Neosartorya fumigata OX=746128 GN=egc1 PE=1 SV=1
sp|I1BTD7|EGCR1_RHIO9	2.36e-67	8	229	22	243	Glucosylceramidase OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) OX=246409 GN=ERC1 PE=1 SV=1
sp|P40566|EGH1_YEAST	8.37e-60	5	227	10	245	Ergosteryl-beta-glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EGH1 PE=1 SV=1
sp|H1AE12|EGCR1_CRYNH	2.29e-54	3	229	18	247	Glucosylceramidase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=EGC1 PE=1 SV=1
sp|A0A3S5YBC7|EGCSE_RHOH1	5.83e-06	5	150	39	156	Endoglycoceramidase I OS=Rhodococcus hoagii (strain 103S) OX=685727 GN=REQ_38260 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000059	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000024811-p1.