CAZyme Information: EPrPVT00000024637-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000024637-p1
• CAZy Family: PL1
• CAZyme Description: Acidic chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
213		22547.46	4.1097

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC2646:343-981(+)

Full Sequence      

MLTTRVLASALLLATAVSSIRAGNPGCGVPDQSSSAPTTTSPATTAPTGTPEPTTETPST
TSPPATSSSTSGSGSGFTRFFDKAAFEDSFPNQIKLYAFQGFVDATDAYPEFANTGDDDS
DKRELAAFLAQTAHECDNFQAAEEYAAPTYSESHYCDDSTVPCAKGHRYHGRGPIQLTWN
YNYNSAGEALDIDLLNNPELVSNTSSISWMTAL

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	79	213	8.7e-46	0.6233766233766234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	1.02e-43	81	213	1	149	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	2.44e-34	97	213	25	151	Chitinase class I.
225720	COG3179	2.97e-05	125	213	42	159	Predicted chitinase [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAN31509.1|GH19	9.14e-63	75	213	25	163
CCD28125.1|GH19	4.78e-61	68	213	44	189
UIZ22871.1|GH19	8.25e-61	69	213	40	184
AVH63884.1|CBM50|GH19	4.37e-39	74	213	74	211
BAY91283.1|CBM50|GH19	5.47e-39	73	213	155	293

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4IJ4_A	5.10e-37	78	213	4	137	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	5.24e-37	78	213	5	138	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
2CJL_A	4.86e-34	83	213	5	135	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
1WVU_A	6.65e-32	70	213	51	196	Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	1.85e-31	70	213	51	196	Chain A, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P24626|CHI3_ORYSJ	1.57e-29	70	212	69	229	Chitinase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht3 PE=2 SV=2
sp|Q5NTA4|CHI4_CRYJA	2.15e-28	96	213	103	218	Endochitinase 4 OS=Cryptomeria japonica OX=3369 PE=1 SV=1
sp|P21226|CHI2_PEA	1.31e-27	68	213	57	220	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2
sp|Q41596|CHI1_THECC	1.74e-27	96	212	98	224	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
sp|P86473|CHIT_ACTCC	4.80e-27	96	213	99	226	Endochitinase OS=Actinidia chinensis var. chinensis OX=1590841 GN=CEY00_Acc04863 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000876	0.999120	CS pos: 22-23. Pr: 0.9543

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000024637-p1.