CAZyme Information: EPrPVT00000024124-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000024124-p1
• CAZy Family: GT71
• CAZyme Description: Beta-glucan synthesis-associated protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
391		42383.62	3.8991

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC1787:854-2180(-)

Full Sequence      

GANNQDVPTAYYESLRGHVSWYQGLRYGANNLCDVEEDLIQTYATINASLEAGITENACT
MALCPASYDNAYTGAFLCSAGNNNSECDASSGSTSSASEYAYQMDAISANWEVHMAAYMD
WVVYTLEWVMGDEGYIRWMIDGQPIFEITADVLTNPPQNSAQTNPKKIMIEEPMYIIFNV
ALSTSSQDAAICDSFPMYLKIDYIRLYQDTSSGTSMAIGCDPSTHPTAQWIEDNIGDYTD
DDNTWKKVSGMAFCESDNDCTINSGTTSSIITGSCVDSRCECKSSTWSGPRCTQVSTSTS
SSSSSDSDDEDTSYGPPMYATASVGGVTIVATFAAVYLSVISVRKSDEELRKKILLQQQL
QQQKNVGALSATSASDVGLKPAADNYSTNFV

Enzyme Prediction     

No EC number prediction in EPrPVT00000024124-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH16	87	207	1.7e-17	0.3773006134969325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397841	SKN1	4.24e-19	124	254	367	500	Beta-glucan synthesis-associated protein (SKN1). This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
185689	GH16_fungal_KRE6_glucanase	7.40e-16	101	208	187	295	Saccharomyces cerevisiae KRE6 and related glucanses, member of glycosyl hydrolase family 16. KRE6 is a Saccharomyces cerevisiae glucanase that participates in the synthesis of beta-1,6-glucan, a major structural component of the cell wall. It is a golgi membrane protein required for normal beta-1,6-glucan levels in the cell wall. KRE6 is closely realted to laminarinase, a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185693	GH16_laminarinase_like	6.89e-13	120	207	159	235	Laminarinase, member of the glycosyl hydrolase family 16. Laminarinase, also known as glucan endo-1,3-beta-D-glucosidase, is a glycosyl hydrolase family 16 member that hydrolyzes 1,3-beta-D-glucosidic linkages in 1,3-beta-D-glucans such as laminarins, curdlans, paramylons, and pachymans, with very limited action on mixed-link (1,3-1,4-)-beta-D-glucans.
185683	Glyco_hydrolase_16	6.86e-08	120	207	143	210	glycosyl hydrolase family 16. The O-Glycosyl hydrolases are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A glycosyl hydrolase classification system based on sequence similarity has led to the definition of more than 95 different families inlcuding glycosyl hydrolase family 16. Family 16 includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues.
185687	GH16_beta_agarase	1.45e-04	120	208	180	258	Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ27996.1|GH16	1.59e-130	1	294	308	648
UIZ28151.1|GH16	8.81e-107	1	391	312	752
UIZ28149.1|GH16	2.26e-103	1	391	309	754
UIZ28152.1|GH16	4.43e-103	1	391	298	739
UIZ24235.1|GH16_2	2.39e-97	1	337	308	693

PDB Hits     

EPrPVT00000024124-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O13941|YEPB_SCHPO	2.31e-10	131	253	501	618	Uncharacterized beta-glucan synthesis-associated protein C23H3.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC23H3.11c PE=3 SV=1
sp|P32486|KRE6_YEAST	1.36e-09	124	279	579	715	Beta-glucan synthesis-associated protein KRE6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=KRE6 PE=1 SV=2
sp|P33336|SKN1_YEAST	4.14e-08	124	253	631	754	Beta-glucan synthesis-associated protein SKN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKN1 PE=1 SV=1
sp|P87024|SKN1_CANAX	5.11e-07	124	253	606	729	Beta-glucan synthesis-associated protein SKN1 OS=Candida albicans OX=5476 GN=SKN1 PE=2 SV=1
sp|P87023|KRE6_CANAX	5.12e-07	124	253	609	732	Beta-glucan synthesis-associated protein KRE6 OS=Candida albicans OX=5476 GN=KRE6 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000029	0.000004

TMHMM  Annotations     

Start	End
321	343