CAZyme Information: EPrPVT00000024021-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000024021-p1
• CAZy Family: GT71
• CAZyme Description: Acidic chitinase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
246		26371.94	3.9557

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC1668:226-963(-)

Full Sequence      

TTAPATTAPATTAPATTAPATTAPATTAPTTTAPPSNSGFTRFLDEATFEAMFPNQVSLY
AFQGFVDAVDTYPAFANTGDDTNDKRELAAFLAQTAHECDNYQAAEEYNWATYPESQYCN
TTLGACTAGQRYHGRGPIQISWNYNYISAGEALDLNLLDNPSLVSTTSSVAWQTALWFWM
TPQKAGLIIHDEVVKDGGFATSTDVINGDLECGGTAQSNELQRIENYEKMCDLLGVEPLG
KTSCNA

Enzyme Prediction     

EC	3.2.1.14:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	42	244	6e-64	0.9696969696969697

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
381595	chitinase_GH19	7.15e-73	44	244	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
395130	Glyco_hydro_19	7.01e-50	60	244	25	232	Chitinase class I.
225720	COG3179	3.99e-08	41	229	1	199	Predicted chitinase [General function prediction only].
381610	chitinase-like	6.28e-05	90	206	1	100	chitinase-like domain. This family includes proteins such as chitinases, chitosanase, pesticin, and endolysin, which are involved in the degradation of 1,4-N-acetyl D-glucosamine linkages in chitin polymers and related activities. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Chitosanase enzymes hydrolyze chitosan, a biopolymer of beta (1,4)-linked-D-glucosamine (GlcN) residues produced by partial or full deacetylation of chitin. Pesticin (Pst) is a anti-bacterial toxin produced by Yersinia pestis that acts through uptake by the target related bacteria and the hydrolysis of peptidoglycan in the periplasm. The dsDNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall heteropolymer peptidoglycan and cell division.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22871.1|GH19	1.63e-89	36	246	44	256
CCD28125.1|GH19	1.93e-89	38	246	51	260
AAN31509.1|GH19	2.24e-89	37	246	24	234
AKJ27151.1|CBM12|GH19	4.89e-60	44	244	163	363
AMM06751.1|GH19	5.25e-59	44	244	39	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2CJL_A	6.25e-58	44	244	3	204	Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor],2CJL_B Crystal Structure And Enzymatic Properties Of A Bacterial Family 19 Chitinase Reveal Differences With Plant Enzymes [Streptomyces coelicolor]
1WVU_A	8.99e-53	37	244	59	265	Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],1WVU_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_A Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_B Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus],2DBT_C Crystal structure of chitinase C from Streptomyces griseus HUT6037 [Streptomyces griseus]
1WVV_A	2.54e-52	37	244	59	265	Chain A, chitinase C [Streptomyces griseus],1WVV_B Chain B, chitinase C [Streptomyces griseus]
3WH1_A	1.47e-48	41	238	5	200	Crystal Structure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
4IJ4_A	3.22e-47	41	238	4	199	Crystal Structure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P06215|CHIT_PHAVU	2.52e-44	35	236	71	301	Endochitinase OS=Phaseolus vulgaris OX=3885 PE=1 SV=1
sp|P36361|CHI5_PHAVU	6.85e-44	60	236	102	300	Endochitinase CH5B OS=Phaseolus vulgaris OX=3885 PE=3 SV=1
sp|Q42993|CHI1_ORYSJ	1.23e-43	58	244	104	315	Chitinase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht1 PE=2 SV=1
sp|Q39785|CHI2_GOSHI	4.09e-43	35	244	47	287	Endochitinase 2 (Fragment) OS=Gossypium hirsutum OX=3635 PE=2 SV=2
sp|P21226|CHI2_PEA	6.96e-43	60	236	95	293	Endochitinase A2 OS=Pisum sativum OX=3888 GN=CHI2 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000003

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000024021-p1.