CAZyme Information: EPrPVT00000023900-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000023900-p1
• CAZy Family: GT71
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350		39080.64	4.4148

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC1542:2216-3268(-)

Full Sequence      

MAADKAIVGDDTTLLSTCLTKLEALIEPFLANTLEPPLAYETTYSGIVSSMTFTNNDVNV
DFGNGVYNDHHYHFGYWVTASAMLKKLDPNWSRMSELETMVWTLLRDVANPSSDDPYFTT
FRHFSWFLGHSYSHGVTPMADGKDEESTSEDINFYYGMMLWGQVTGKQEVEDLGSLMLRL
NARAIQTYFLMTSDNAVHPAAFVKNHVTGIFFDNKAHYTTWFSAEKYCIHGIQMIPVSPI
NSFVRTQTFIQEEWDDVLSKEPIVAEADLSNAWLSLLLVNAASINQADALSKLTTVTLDD
GLTRSWALYNAATRGTHPSTFVSDQVSSSANLDATRREYTIEDSDAAAVS

Enzyme Prediction     

No EC number prediction in EPrPVT00000023900-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	10	309	2.1e-112	0.4678456591639871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	2.19e-132	8	308	51	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.49e-93	11	319	453	760	Endoglucanase Acf2 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	1.08e-180	1	315	427	741
UIZ26440.1|GH81	1.08e-180	1	315	427	741
UIZ26131.1|GH81	5.47e-142	1	318	401	718
UIZ26137.1|GH81	3.90e-141	1	318	511	828
UIZ26602.1|GH81	3.90e-141	1	318	511	828

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	6.96e-68	19	337	420	738	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	9.79e-68	19	337	445	763	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.62e-66	19	337	420	738	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.52e-26	68	258	414	603	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	4.97e-19	68	302	439	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.94e-72	7	318	398	706	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	1.49e-65	7	312	432	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	3.30e-65	7	308	802	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	4.38e-64	7	312	593	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	7.56e-62	11	285	473	744	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000049	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000023900-p1.