CAZyme Information: EPrPVT00000023617-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000023617-p1
• CAZy Family: GT60
• CAZyme Description: Beta glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
598		64671.93	4.4037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC1336:2681-4561(+)

Full Sequence      

MFKSWLTPLVVAALGLSAASADQWDAQVDAIMANFTTEDIIGQMSQISIYGLVDDDLNID
EDIVRAYAKLKVGSYLGAPLSSGYTYTNESVKYAWTAEQFRTAVAKIQEITMEENGGHPM
VFGLDSVHGAGFVADTVIFGQQINGAASFNPDLVYKMGQVTARDTLAAGIPWVFGPILEV
SSNPMWPRTYETFGEDPYTISVMADAVIRGLQSNNATAACMKHFIAYSKTPSGHDKDPVT
ITDFDLLNYFARPFKAAVDAGVLSTMENYVSINGVPTIQNTKLMSSLLRSDLGFDGVAVS
DYSEINSQQSFHRVARSTDEAARFSLERSSLDMSMIADDISFINGTKLLLERNPGILGRL
TESARRVVKMKVQLGLYDNPMPGEEYLEQIGNADDVAAALEMARESIVLVQNNETTLPLA
NGTAVFLTGHSADNIAYQCGGWSVTWKGISGKSNFPLGKSVKDGLEAIVGSDSVTYFNGL
YANGTYSADDLASAKELAAKSEYTIAVIGEAPYAEKTGDIDDLALPAGQIEYVKELAATG
TKVIVAVAEIIYGQVNPSGRLPLTYPKNPANIAMPYNHRVSTLCADSKNCEMQWEFGH

Enzyme Prediction     

EC	3.2.1.21:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	114	317	5.5e-57	0.9305555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
185053	PRK15098	1.75e-66	22	578	32	612	beta-glucosidase BglX.
224389	BglX	2.72e-63	36	445	2	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
395747	Glyco_hydro_3	2.02e-46	36	367	1	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	3.92e-32	79	574	35	598	Probable beta-xylosidase; Provisional
396478	Glyco_hydro_3_C	1.89e-26	407	578	1	206	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29009.1|GH3	2.61e-232	1	597	1	627
CCA27737.1|GH3	9.24e-210	26	598	66	672
UIZ27116.1|GH3	1.06e-203	44	598	1	586
UIZ29432.1|GH3	1.75e-202	1	597	1	626
UIZ29613.1|GH3	2.56e-202	1	597	46	682

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JP0_A	4.82e-82	32	567	21	596	Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus],5JP0_B Bacteroides ovatus Xyloglucan PUL GH3B with bound glucose [Bacteroides ovatus]
5M6G_A	2.04e-65	27	568	50	590	Crystal structure Glucan 1,4-beta-glucosidase from Saccharopolyspora erythraea [Saccharopolyspora erythraea D]
6JGC_A	4.63e-60	27	574	19	584	Crystal structure of barley exohydrolaseI W286Y mutant in complex with glucose. [Hordeum vulgare subsp. vulgare],6JGD_A Crystal structure of barley exohydrolaseI W286Y mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare]
6JG7_A	1.70e-59	27	574	19	584	Crystal structure of barley exohydrolaseI W286F in complex with methyl 2-thio-beta-sophoroside [Hordeum vulgare subsp. vulgare],6JGA_A Crystal structure of barley exohydrolaseI W286F in complex with 4'-nitrophenyl thiolaminaribioside [Hordeum vulgare subsp. vulgare],6JGB_A Crystal structure of barley exohydrolaseI W286F mutant in complex with methyl 6-thio-beta-gentiobioside [Hordeum vulgare subsp. vulgare]
1LQ2_A	2.08e-59	27	574	15	580	Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme Exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X38_A crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare],1X39_A Crystal structure of barley beta-D-glucan glucohydrolase isoenzyme exo1 in complex with gluco-phenylimidazole [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q23892|GLUA_DICDI	6.42e-101	25	581	77	682	Lysosomal beta glucosidase OS=Dictyostelium discoideum OX=44689 GN=gluA PE=1 SV=2
sp|A7LXU3|BGH3B_BACO1	3.22e-81	32	567	43	618	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
sp|T2KMH0|PLH24_FORAG	8.61e-49	106	579	49	576	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
sp|Q56078|BGLX_SALTY	3.22e-48	25	578	35	612	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
sp|P33363|BGLX_ECOLI	5.98e-48	119	578	105	612	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000301	0.999699	CS pos: 21-22. Pr: 0.9743

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000023617-p1.