CAZyme Information: EPrPVT00000023375-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000023375-p1
• CAZy Family: GT48
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
831		88692.18	4.1139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC1202:151-2733(-)

Full Sequence      

MRSKHFCLVPLLGCTVLLASQTAARDVGTPPLYGEFVPKKFALGATPTIPTASYTDGETV
VSLTPDLPCATLDYGFEMAGQPMLHVQALSGPVEVEAKYAEAFTSLSQELSDGPFSWTAP
LANSHRVQTFRFSTLDESVTTLTQGGQRWQTLCLLTGDGVSFKRLAFRATVPVVESEASA
LPGSFVSSDATYNKIWDLGPRAASVACIAAESQPEIWSVDAENGTYVPGTRPGISYKTWN
LTDYVLEFETKLVRGGMGVTIGFTMADNSDGIQLHLASEYPNGTTYSNTNTSLFPPSTIR
LAYGYDFVNITTATSYLLDLYQVPFRVPEDEWLAVKIEADAAAHRLSYWLNDTLVFNATV
DSMVNGDQVADPTASGAFGFGGWQDQAAFVRNVVATSRSTGEVLYANPMTDATVVLPEFG
EQTNSYGVCMDGGKRDRLMWLGDFYHTTRILGVGQGIGFENAVTGTWRYVFDYQSSIGQF
PGFLPISYETPMPTPGVFMANAGTSAEVFVFPDYAVLGLLSFVSYMEYSNDTNDTGLLDF
SDGFVTFIGPAAGVAINAASVQAYRGMARVAEVVGDVESAATWTASGEGLAAAININLWN
DELGVYSVEAATPDVFGVSGIAFAITAGVASESQALRSLAHLDELKQGPGYLDTSATDPS
TKISPNTNGFLLDALLQLKQTAPAKFLLDNLWGAMLNDSYASGASWEYVAQDLSPGLSDF
TSLAHPWGGAASYALTNFVAGIRPVDFGFATWIIEPIVAGFGLDNVSSKVTTPFGTLSVD
WARDNSTNSLLVTIASPAGTSGVFQVDQPSSNSTFTHNITGGGSDTFTVQL

Enzyme Prediction     

No EC number prediction in EPrPVT00000023375-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	420	803	3.8e-44	0.7380952380952381

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
379972	Bac_rhamnosid_C	5.01e-06	741	801	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
407469	Bac_rhamnosid6H	0.001	424	730	27	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD52401.1|GH78	1.01e-174	38	806	27	812
ATZ56607.1|GH78	2.90e-174	38	806	51	836
QMW40986.1|GH78	1.26e-171	17	804	15	806
QMW28911.1|GH78	1.26e-171	17	804	15	806
QRD85156.1|GH78	1.26e-171	17	804	15	806

PDB Hits     

EPrPVT00000023375-p1 has no PDB hit.

Swiss-Prot Hits     

EPrPVT00000023375-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000372	0.999626	CS pos: 24-25. Pr: 0.9719

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000023375-p1.