CAZyme Information: EPrPVT00000023112-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000023112-p1
• CAZy Family: GT41
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
408		45045.38	5.5613

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC1083:5100-6888(-)

Full Sequence      

AAADSAWQDLAISAPRFGRYLHRTESLEPFFWQADTAWELFHRLNKTSIDFYLSTRAEQG
YNVVQTVVVSELNSTTRANFYGDLPFNNSDPTQPNEAYFELVDWTTELAASYGILLALVP
TWGMYVNGGWHTTEPIFNETNARQWGNYIGARYPGLPKILGGDSNVLWAQNVSAAQDAFT
ADPTLDPVSLVGPIVDTASVWASMRAGLVEAEAALGHEAVVLYHPTNSWLVKPEVTPEPY
AHLTSEPYAHNMLPNEADCVSINGVQSGHNIPDGARRLRLAKPLWNASHIRTGLYHGVYS
GAAGFTYGANSVCQLYEPRADLLRDSDWYPAQINQNASGSWRRDIFFEGATQIQHVTKPL
QILGTTELELLGRSSPADGFGARVPPRFKSIKICMPRNLPASEGKSKS

Enzyme Prediction     

No EC number prediction in EPrPVT00000023112-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH140	18	358	1.9e-53	0.75

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
404153	DUF4038	1.35e-97	18	363	2	320	Protein of unknown function (DUF4038). A family of putative cellulases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
KAF2142288.1|GH140	2.69e-118	7	380	28	432
KAF3763706.1|GH140	3.06e-104	7	352	27	410
KNX49908.1|GH140	1.05e-56	18	358	22	403
KAE8156220.1|GH140	2.06e-50	3	366	17	407
KAE8346205.1|GH140	2.32e-50	3	366	17	407

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MSY_A	6.86e-17	7	318	13	315	Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_B Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482],5MSY_C Glycoside hydrolase BT_1012 [Bacteroides thetaiotaomicron VPI-5482]
3KZS_A	1.69e-15	7	318	13	315	Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_B Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_C Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482],3KZS_D Crystal structure of glycosyl hydrolase family 5 (NP_809925.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 2.10 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

EPrPVT00000023112-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000068	0.000001

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000023112-p1.