CAZyme Information: EPrPVT00000022747-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000022747-p1
• CAZy Family: GT33
• CAZyme Description: Alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1305		144852.47	4.6243

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0957:2704-6621(-)

Full Sequence      

MPSARFAGAYNEAMAGGTQTPPDAPSAGFKEREADLLRELSALYTKLNQVREKRAKAEQE
STAGVDGAGNQGDGDASGGSRRRRRVLLVTRSLPFRLISEDAQSQWRAEFLEHASLDGAM
ETYLCLHENYECVWIGSVHGEVEPQEQKTLKEQLLQERNYYPVVLDPKREKLFYQGFCKT
VMWPLFHSFPPTTDDMLLTHEMDLASTAFGPEDDHSMEKMWQAYVAVNQAFADAVQEVYE
EGDLVWVQGYHLTLVPQMVQNLFPNENVHLGYFMHIPFPPAELYRIMNYREEILTGILGA
DLVGFQTYEYARHFQSAAVRLLGLESSHKGVECNGHFARVTICPVGIDADKYLSLVQSEA
VCAARQQLTDQFAGKKLLLGVDPLDLTKGLVHKLLAIEELFTLRPELAKEVIFLQIVTNA
ASSLTLTESTSVLGSQVEALVSRINSKLQDVGADGPVQYLNKDISEEDLVALYSIADTLV
ITPVQDGMNTVPFEYVACREAAGQHARVVLSEFAGCAQSLGGAVLINPWNTEELVDSLVR
SLDDNDEVMRQHQHMYSYVSTFTSRHWADNFLEQLRECSEENALAGSGRELSRRDMTSAY
SRSMRRLLFINYEGVLAPESSIPELSYPPQELIWQLAMLTSDPRNTVVLVSSRSTAVCEQ
WFAGLSGNVVLAAEYGVYIKWLGDREPWHCMVPNLDLSWWEHVVPLVEYYTERTPGAFME
RKDSSIAWHYRDCDLDHGLWQASELLVSLRELTRSLPVAVCPGNRCLEVRPNKVSKATLF
ERVWEFMNWSTLFPEDERVTTEYFGEEIKPAMSPLVTPRGVFPTSYKEWKTKNGDESSPF
RVTDEDDGDHKRKSGDAASESDEGDGKDVAGRQQRHELAMDADNERAVDFVLVIASGDDR
TDEDLFAVLVPPPIDLEAYCKQLEKEEMEQSSPEQQVNSGDEGSASLGIDAVKVSITNLN
EGGNRPPPSPTDIVARRRSDRLSTSSLPSMGSGKNNASASDVLLSDRPPSFARLPTRTGS
EADFLGLGENLTKLTPVAKPAVSDDAANMFPRTLLTTPSNARRDEITEKSKFTPRRDFPP
SAALFKAMRAKYGDNFGIHKMPDTPAACWALVLPPTARAKLEDGSGSNLSLTDSSAQRRS
SLDRRTSLGSFTGIATSGLGYESPGYELEDNAVGSATGESIASVSTVTSVTDFDEGSPLT
TDKNESERGNLITTRILEGVDAGVNENETNDEEEQYRFPVNTFVCTLGRKLSQAPYFIKN
SGELFQLLQEMGMSSHIRRQRMLSLGSAMAPGVESKNGSELKRFL

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	81	576	1.1e-144	0.9768421052631578

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	0.0	126	776	37	658	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	9.94e-161	126	576	37	463	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.04e-145	109	575	23	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215556	PLN03064	1.84e-140	14	783	1	776	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
177855	PLN02205	1.79e-137	128	819	103	812	alpha,alpha-trehalose-phosphate synthase [UDP-forming]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA15235.1|GT20	0.0	30	1284	28	1218
UIZ28038.1|GT20	0.0	26	1287	4	1241
AJA04606.1|GT20	1.11e-149	33	783	65	806
AGT80036.1|GT20	1.11e-149	33	783	65	806
QOX06485.1|GT20	3.81e-146	30	788	16	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HVM_A	1.70e-89	80	583	8	482	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUV_A	2.88e-85	85	584	5	476	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]
5HUT_A	3.95e-85	85	584	5	476	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HVO_A	2.70e-84	76	579	3	478	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
6JBI_A	2.06e-82	85	575	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	2.60e-141	70	783	2	673	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q54NU9|TPSB_DICDI	6.04e-129	89	783	52	725	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] B OS=Dictyostelium discoideum OX=44689 GN=tpsB PE=3 SV=1
sp|Q9LRA7|TPS9_ARATH	1.19e-124	65	783	40	765	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 9 OS=Arabidopsis thaliana OX=3702 GN=TPS9 PE=2 SV=1
sp|Q0WUI9|TPS8_ARATH	2.42e-124	65	783	40	760	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 8 OS=Arabidopsis thaliana OX=3702 GN=TPS8 PE=2 SV=1
sp|Q9SYM4|TPS1_ARATH	6.83e-121	83	783	91	774	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000043	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000022747-p1.