CAZyme Information: EPrPVT00000021582-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000021582-p1
• CAZy Family: GH81
• CAZyme Description: Polysaccharide lyase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
237		24889.03	3.8037

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0687:564-1360(+)

Full Sequence      

MVKTFATASLALAATAAVASAASMRAQSSMPDGTWPTSQGTVEYDEVYVVAAGETFDGGL
KTYQRSDITCEGQEESGTSTAVFSVEAGGTLKNVIIGANQMEGVHCDDHDCTIENVWWDD
VCEDALSIKGGSASSVSTVTGGGARSADDKVIQHNGYGTRFVNLNNVYVVNPGKSIVTVN
DNYGDEATLSNIQISASDDSYDICAWSQASEDGEPEELGAGIKDPLCQYSDSDITYV

Enzyme Prediction     

EC	4.2.2.2:4

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL3	38	160	1.5e-53	0.6237113402061856

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397360	Pectate_lyase	1.93e-67	33	204	2	190	Pectate lyase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADN18837.1|PL3_2	5.00e-97	1	237	1	261
ADN18841.1|PL3_2	9.57e-96	1	234	1	250
ADN18838.1|PL3_2	1.87e-84	1	159	1	153
ADN18840.1|PL3_2	8.00e-84	20	236	20	260
ADN18839.1|PL3_2	4.67e-76	30	237	23	276

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EE6_A	1.48e-21	46	176	7	131	Crystal Structure Of Pectate Lyase From Bacillus Sp. Strain Ksm-P15. [Bacillus sp. KSM-P15]
4EW9_A	6.08e-16	40	193	6	157	The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725],4EW9_B The liganded structure of C. bescii family 3 pectate lyase [Caldicellulosiruptor bescii DSM 6725]
3T9G_A	6.20e-16	40	193	7	158	The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii],3T9G_B The crystal structure of family 3 pectate lyase from Caldicellulosiruptor bescii [Caldicellulosiruptor bescii]
4Z06_A	3.70e-15	40	193	15	166	C. bescii Family 3 pectate lyase double mutant K108A/R133A in complex with ALPHA-D-GALACTOPYRANURONIC ACID [Caldicellulosiruptor bescii DSM 6725],4Z06_B C. bescii Family 3 pectate lyase double mutant K108A/R133A in complex with ALPHA-D-GALACTOPYRANURONIC ACID [Caldicellulosiruptor bescii DSM 6725]
4Z03_A	5.12e-15	40	193	15	166	C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725],4Z03_B C. bescii Family 3 pectate lyase double mutant K108A in complex with trigalacturonic acid [Caldicellulosiruptor bescii DSM 6725]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5BA88|PLYD_EMENI	8.40e-50	36	231	43	259	Probable pectate lyase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyD PE=3 SV=1
sp|Q4WGV9|PLYD_ASPFU	5.07e-49	36	231	23	237	Probable pectate lyase D OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=plyD PE=3 SV=1
sp|B0YB89|PLYD_ASPFC	5.07e-49	36	231	23	237	Probable pectate lyase D OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=plyD PE=3 SV=1
sp|Q5ATC7|PLYH_EMENI	1.19e-48	36	231	41	255	Pectate lyase H OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=plyH PE=1 SV=1
sp|A1DCY5|PLYD_NEOFI	5.54e-48	23	231	9	236	Probable pectate lyase D OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=plyD PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000398	0.999575	CS pos: 21-22. Pr: 0.9597

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000021582-p1.