CAZyme Information: EPrPVT00000021288-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000021288-p1
• CAZy Family: GH72
• CAZyme Description: N-acetylglucosamine-1-phosphotransferase subunits alpha/beta

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1798	PvexDAOMBR484_SC0638|CGC1	200801.31	5.0179

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0638:10553-16550(+)

Full Sequence      

MALEPASSLRQLLSPKILLVLAMMGIVANFWYRLAAFDPTVTEVGDGAIKLVINQAVPLE
ESMLTSVPLEEAMPASVPPESGLSMATPFANLRELEQFELTNEFSVFTRELDDPAASHYY
AKVFAVVYSAFDQILFLDADNYAVRDPSFLFETPVFRATGAVFWPDFWQPSNSYFSMPSL
GATSFVWELLGIDFFNLLALEYEPKKLLAFATCRRELLHQNPSLASIASTDNSFFRRGIV
IVVYPKLLMSVFASVRSLRELGCHLPIELWYSPSEMDSSHPVVARLTSEFKVFTRELDDP
AAAKYYAKVFAVVYSAFDQILFLDADNYAVRDPSFLFETPVFRATGAVFWPDFWQPSHPH
FTHLTAASFAWELLGIDFAGRENTADVFCGFTMVQHDPDGDVLFLHRNSVKLLCGSHRKL
WTHVQQFRPELDLAEYNPAKHATDGLFPHLRTCWGQFRDYNRTHTVLPVADFPFAGLEDR
LIAFADEIESLACHANNGAMETRTRSRRAASSSPRAGASATASGPRWRLAIIGACVAAVL
GAAGALLLEAQAAFGRTHDNIGGVASPEFLAYGPVDVVYTWVNGTDPRWKREKEFWHKHW
IASLTGQPLPKWDDDTSKIKGKDDSNSDNRFRDNEELRYSLRSLEKYAPWVRHIYVVTDG
QIPAWLDIESPRISIVAHRDIFQDKAHLPVFSSPAIEWSLDNIPGLSEWFLYFNDDVFLG
SHVHPEDFVSQRGVQKVYFAWEAPLCSPNCWDTSLQNGRCDRECNVTACDFDMGDCGCDV
NPLDGSVTCDADKIASINEQSPRAPKLADHLCLGRCHFSWLGNGHCDRACNVSGCGFDGG
DCGVDALAELPTAELTVNQTLVHVPLAVNATVLNLTSAFGVNGSISSAGHDNSVLVRHAT
VLEQDMLLLLTFGRDPETGDPFTSSTAISVVGQDADGNERTIEVSVVRGRTQLETSATAA
VAANWTASNASEAHRMLEASQGWPSDGALSGGFATFQNTTIRPRNIRLPFGFRQAVFAER
DVEDEDVVGEGDEFLALEVFLPFNLTGKKLKDGDELNLGWALQWRVHDDMSEDGTDFDWS
DAQTCRLSMPKKEIDPQKQRLEVYKRKPVEAAVDTMTTTTETTGTVAEHKPDAEPLKKAG
LKPGTFAFDMLEALGKQDDTSLAKELLEALEQEELRQQEHHGQSDSAAEIIEQPTPTEEH
TSDDIEVPSCELVEVDGKRRGIRVTLRIPTLSQRAELSTTTHNDGTPIAADEGTASGETV
KVGDVSEGEATHGPQIADGHVCFFDADREEPKRYCFALTAGHFHAHEQQVVHQPTLWGLL
HPPRPVVKYAPYRGENEAFIELTKRCIDATERVAGMRPALCGLREVPISVPSDTIVDPAK
VKEEEGRRLACAAQRQRLALKEQQGKDEEAAAASLFGGVLARVKASLGLSMVEPTHEVMD
DVQYADVCGDQPVEAPSEPISERNAQALLSKDTFGDSLRFVNKLYNRAFGKASSRRRVPS
HMPFMFKKQYLREIKEHWAAETTSTSAHRFRHPEDMQFSFSYFHYLLNRHKVHPPTLEQI
WRDYLDANRNGILDENEVLTVASLAFGDYPPDTFVTEVRECLQPAKTEKVREQPTAAGTV
RLAETLTPYITFADLERCTDISEKLLRNVRREPLGELMSEDEVTFHMLSDNYKFAWNQML
GTRARRTKFVCINDDMKYPTPAVSQILHELFLSIWPKRSQFELPFHLKNRYAHIDEVAAA
RDRGLLAWRVTAGIALLLALLFRRHLLSFFGFHELARARAASASQLQQEMATEQDKDD

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	237	366	2.5e-31	0.5227272727272727

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
402818	Stealth_CR2	7.70e-62	630	737	1	108	Stealth protein CR2, conserved region 2. Stealth_CR2 is the second of several highly conserved regions on stealth proteins in metazoa and bacteria. There are up to four CR regions on all member proteins. CR2 carries a well-conserved NDD sequence-motif. The domain is found in tandem with CR1, CR3 and CR4 on both potential metazoan hosts and pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system.
402574	Mannosyl_trans3	4.59e-21	237	364	2	143	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
407245	Stealth_CR3	1.98e-14	1500	1547	1	48	Stealth protein CR3, conserved region 3. Stealth_CR3 is the third of several highly conserved regions on stealth proteins in metazoa and bacteria. There are up to four CR regions on all member proteins. The domain is found in tandem with CR1, CR2 and CR3 on both potential metazoan hosts and pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system.
407246	Stealth_CR4	2.40e-12	1681	1733	2	56	Stealth protein CR4, conserved region 4. Stealth_CR4 is the fourth highly conserved region on stealth proteins in metazoa and bacteria. There are four CR regions on mammalian members. CR4 carries a well-conserved CLND sequence-motif. The domain is found in tandem with CR1, CR2 and CR3 on both potential metazoan hosts and on pathogenic eubacterial species that are capsular polysaccharide phosphotransferases. The CR domains also appear on eukaryotic proteins such as GNPTAB, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta. Horizontal gene-transfer seems to have occurred between host and bacteria of these sequence-regions in order for the bacteria to evade detection by the host innate immune system.
402574	Mannosyl_trans3	1.68e-10	122	169	84	133	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24000.1|GT71	2.54e-70	218	485	228	564
UIZ24059.1|GT71	1.67e-59	227	487	843	1172
CCA25989.1|GT71	2.04e-52	208	509	185	560
CCA20051.1|GT71	1.15e-49	199	484	167	529
CCA20955.1|GT71	3.50e-39	222	491	214	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7S05_A	1.34e-76	612	1743	274	1177	Chain A, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta [Homo sapiens],7S05_B Chain B, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta [Homo sapiens],7S06_A Chain A, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta [Homo sapiens],7S06_B Chain B, N-acetylglucosamine-1-phosphotransferase subunits alpha/beta [Homo sapiens]
7DXI_A	8.63e-49	558	776	2	190	Chain A, FI02838p [Drosophila melanogaster],7DXI_B Chain B, FI02838p [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5RGJ8|GNPTA_DANRE	4.01e-75	612	1737	309	1163	N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Danio rerio OX=7955 GN=gnptab PE=1 SV=1
sp|Q3T906|GNPTA_HUMAN	7.01e-75	612	1743	304	1207	N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Homo sapiens OX=9606 GN=GNPTAB PE=1 SV=1
sp|Q69ZN6|GNPTA_MOUSE	2.31e-72	612	1743	304	1186	N-acetylglucosamine-1-phosphotransferase subunits alpha/beta OS=Mus musculus OX=10090 GN=Gnptab PE=2 SV=2
sp|O69853|Y6023_STRCO	3.67e-37	565	740	266	419	Exopolysaccharide phosphotransferase SCO6023 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO6023 PE=3 SV=1
sp|O69851|Y6021_STRCO	4.09e-34	567	738	221	378	Exopolysaccharide phosphotransferase SCO6021 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=SCO6021 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000017	0.000021

TMHMM  Annotations     

Start	End
12	34