CAZyme Information: EPrPVT00000021137-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000021137-p1
• CAZy Family: GH7
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
825	PvexDAOMBR484_SC0616|CGC1	88614.39	7.0709

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0616:9483-12329(-)

Full Sequence      

MAKYKTTTLTLAALALSGALAPVSEAACVAVNGNCGSDSTGASCCTSGNYCQPWNPWYYQ
CVAAPAKCPSVEVGVDYYGNDIKTVYNLSPADCCAQCSTTTNCKAFTFVNYNADGRTACY
LKTGSGTKKASIESTTGMNTLCAPLHLGASIVGSRPIPTNKWWGNLIACDSSSSISTVWA
QPYAIQASIGSSPGLAFSYPYRSRVTGGSTGNGNAIQYYYHSFVREFAFSASEFQSSTTF
QVTDWSDLGVQTKFTVSGGTMESFLVQGMAYASVTYTGSLTPKISSDASITSVNGKTSGS
VSSSKFTIVYSTGQTWILYPLTADGLTSKYITLTISGSTLTASAAYTGIFRAALVTQSTW
TTTLDTYRNCIVQGGTVSIADDSTYSFDWKTTGNCASGLLHFALPHVTETMDTTTGTAKV
TSMVGSSTTHGALQAFTTAASSTPKWTMKVTQDVPTGFYPANKIDSTTAQAQGLLALLQS
DINADWSIPVGGSLYFNGKYALKYASLCLVANDPTVVGTNTDLLATCLSKLRTVMEPFVS
NTWTYKLKYDAVYGGIVGSGGIAVNDRYYDYGNTIYNDHHFHYGYWVHAAAIINSLDPTW
SKLSALNTMAGLLARDFASFSTSDANFPRFRNFDWFSGHSQAHGLTTSNDGKDQESASED
VNAAFALYMFGQATSNAQMAVVGKLLTRVNTHAIKSYYLLLNSNQNHPANFVPNKVAGIL
FDSKCDYTTWFSSEKYAIHGIQMLPVSAVTQFVRTPQFVAEEWNQVLSAQSIVTTPDYTN
AWLSLLYLNYAIVNKAVAMPKLQLAALDDGLSRSWAIYMAGSYVN

Enzyme Prediction     

No EC number prediction in EPrPVT00000021137-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	153	818	1e-173	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.72e-140	467	817	3	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	5.00e-135	156	821	89	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	8.90e-52	154	460	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.
238533	APPLE_Factor_XI_like	2.05e-12	65	137	2	70	Subfamily of PAN/APPLE-like domains; present in plasma prekallikrein/coagulation factor XI, microneme antigen proteins, and a few prokaryotic proteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions.
405052	PAN_4	5.80e-11	75	122	1	51	PAN domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20868.1|GH81	5.81e-278	132	823	95	792
UIZ20873.1|GH81	8.24e-278	132	823	95	792
UIZ20872.1|GH81	6.66e-277	132	823	95	792
UIZ20875.1|GH81	6.66e-277	132	823	95	792
CCA25006.1|GH81	5.80e-224	132	823	39	736

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	8.16e-87	149	822	33	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.35e-86	149	822	58	742	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	4.01e-83	149	822	33	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.04e-28	489	798	334	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.08e-23	481	809	349	664	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	2.10e-86	156	823	225	903	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q09850|ENG2_SCHPO	1.01e-79	144	820	25	699	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	3.94e-79	144	825	421	1114	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.53e-76	218	825	139	740	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q12168|ENG2_YEAST	3.66e-66	156	823	110	778	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000216	0.999760	CS pos: 26-27. Pr: 0.9742

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000021137-p1.