CAZyme Information: EPrPVT00000021006-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000021006-p1
• CAZy Family: GH6
• CAZyme Description: 5A endo-1,4-betaglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
535		58040.43	4.2379

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0597:5313-7218(-)

Full Sequence      

MSQAGRSSHSGARTSEVERIIAAADVDTTFAGKKAMRYRGRRSTWPGALGLFILVVGSIA
GLTYYGIQKHNDVQTAVVSSEAAQEATYTSGEQIDDGGAADTTTDISITNPKTYEARGCE
QPNFVSKDGRIYAEVSTGTKQIDIKGVNWKGMQDSKGVPKGLWDNTLNGDTLYRFGYFLK
NNKFNAVRLPLSIDSVLRNVEIDSNLINTNSNRALGKASRYNTLIGLIVQGLGQFNIGVV
LDFDVLSATESTDTGLWYGTSIQLADIKTAISNLAEALCDSTHFNVIGIDLKDGLSTDAT
WGDGSDTDWSVAATTLGNHLLTECPSWLSFIQGVEGDSHKDTYGDRSIKNTFLLGSDLTG
VTSDPIKLDTDNKVVYSPKYYSSSYLPRLFFFEDGTTNGDMLDDYVELADADLLSNVELN
MNYSFGAAMDTDMAVVLSSFGGLVGDADTTDKKTSQRIIENVISRMTTTDGQFLAGGFFS
TLNPDYYWPYPAPDDDNSTTQGLVDDTWRAANMDVLDVLANMNDMAGLNFIPCVT

Enzyme Prediction     

No EC number prediction in EPrPVT00000021006-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	140	485	2.1e-127	0.9912790697674418

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	8.75e-05	132	336	35	231	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ25210.1|GH5_20	7.59e-289	5	535	11	542
CCA23923.1|GH5_20	6.39e-190	2	534	4	536
CCD28218.1|GH5_20	4.68e-140	259	533	3	278
ABC87090.1|GH5_20	6.92e-108	12	533	111	627
ABK59037.1|GH5_20	6.92e-108	12	533	111	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1VRX_A	1.18e-18	142	514	21	342	Chain A, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus],1VRX_B Chain B, ENDOCELLULASE E1 FROM A. CELLULOLYTICUS [Acidothermus cellulolyticus]
3VVG_A	1.43e-18	114	524	8	377	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	1.43e-18	114	524	8	377	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3QHN_A	1.47e-18	114	524	41	410	Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_B Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHN_C Crystal analysis of the complex structure, E201A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]
1ECE_A	1.58e-18	142	512	21	340	Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus],1ECE_B Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose [Acidothermus cellulolyticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	1.18e-17	135	391	47	285	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	2.69e-17	142	512	62	381	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999884	0.000104

TMHMM  Annotations     

Start	End
45	67