CAZyme Information: EPrPVT00000020936-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000020936-p1
• CAZy Family: GH53
• CAZyme Description: Gamma-tubulin complex component

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
4380		472143.45	5.4044

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0586:386-15542(-)

Full Sequence      

MTTRPTGDLSGTASSYAVDLEVDTTTTASTRSGADPLTPRSRRALEKTLSNMENTTQRGG
SGGVFTNATTSTTTSSNNTPTSRESLYGAGPRAPTSQVRHDGGDKLQQPLYQMSPHRALM
HRLDNVMGTTALHKPGAAPTTQGPVSTFGGTASMASSYTSYGGSMNSTPTSSAAVAAAAA
AAAVAGLPSRYRKVALAGDQAEYTSCGTEILYNTLIRLRLNNHQYLRVAHAPASTKEQQA
LPPRHPTSTGSRSRQGSSIKIDAGGDGRSGDDDQVFVLLNASLRTDCAEVHYSDTVALYC
VAGTCKGHFLSADSATQGLTVKKGPVISNNEKWKLINPNVPSEARDDSSGFGTVPVSSGR
PEDAFLSVQSASLMWEKQKTLATSDKLMLKMNNADVFLSVHSGGSSTEPVILRKENDGLD
DVIQTWEITKSNIPYDPEWNRERGYLTGEALVQVSSKRDVFNETSSRQLSTLPPSAQEAI
MLDELLYVFLGLEGRYIKLDVAETRTDAAKSIRTFKFVLNQPAMDPAISTLASRCFRLGE
FYLHLNLYIEQFSRYEYGQVNHALCAALKVLLKEFTIVVGQLERQMKSRGVDHEQFTLQK
LWSQIQPSLRTMEMLSMLVDACRKTMGGGSLLTEIQNMMSSLAGDLKARQVFSFLMERAT
VPYLKMVERWIYHGDLVDPYDEFMIRRDDQVGKEDVSDNPYSTYWESRYTLRKSQTPLFL
ERFEQKILTAGKYLNIFRTCNRQVDCPFAGPIFYSAGDSAYEEMIERAHTFASRILLDLF
LKENDLVNRLSSIKHYFLMDQGDFFVDFMHVAEEELKLRADKLSLSRLESLLHLSLQTST
CASDPYKDDLVCFLSPHNLISQMEAIHQRAQKGPRDSLTTFASSSIGQLGYKVVDAFTLD
YKVKWPLSLVISCGALTKYQMIFRHLFFCKHVEQQLCDAWLYHQTTKELSLRSALGPSFC
LRQRMLHFQQNFVYYMMFEVISPRWHDFNRQLADAETVDDILELHRDFLDICLKECLLTD
PDLLRVLTKLMTVCTTFANSIERFTRPHFLDEETIKAEREAERDRRAEKRAREEAEAAIA
SFQRQSGMLGKKKVGSLKRRQSSHVDMRRARIQALSDDVKQALTARDGDRENPFARMTSD
HENQFDSLLGDFMDQLLRRSLLQIVVGGREKRRRHGVQQVVDDSRVKSVACQCHATQLTV
LVQPLNSVGGEPLALQPVVALTDDNGNILTGISDGTIRVVTGQAPSSYVTVQPTNNSFPF
VNGIAKCSGLIINQAGKDYTLTIISLSHGVRTETSTFDVVVGPRFKLAILADISTAYGGT
PFLPQPQVGVVDKGGNVVTSTKEGTVRIEIIKNPVGGLLLPGANLNVSIGVGVAKFQGVF
IDVAGSPYTLRYTTSLVLDGGSTITTNPFTVANGVCNTLVLLSFPVQATSGKAFGIQPVV
KLIDSGGNTLDDDSSSRIHVAISSNPSSGSLSPSYSIWGFVRRGIAVFRGLNIDKAGSDY
SLVFTLYTKKAGVATWVKSHIEKISPLFNIVKGTPVALSLERNLSDGVLDGQPSDQQPII
AMVDAGGNVVDSLSAGAITATVVYSASVTASIVVNTTTAPSLVITRVRAPPTPLYPAPYG
VGARLLIEVVFSDDVFVSGIPLLALNSSSTSGPSGVAECVTISTWTTSILFHTVVINTTS
PVIESVKSTVPGNGDYGTGEQIYIEVKFSRFVTVVSAYDSHNTNSRVHLDIRDSDALDLN
GGSITRYVARGTGGKPADISLANAVSNGKSLQNNAQIDIDGIPPAVQSVAFSSSPPSTVQ
RNDTVAITISFSSRVVVNATGGTPSLEMDVGEYNRQAIYTSGNKSLALTFVYTDNEATTS
LDKVDDNSIDCALLCKIINYNGVVVNTSLAGINLLPQGIKIDTQAPTIVSVYSVTPVVQA
NGNSFVVGDRIDIVVEMSLDVYIDPPPSVYPEKAPLLLLNSAKYGRPVLCTGYFNSSRKL
LLFQYIVQEDDVASQLAYLDTDSLTLNNGQCTIRRFSTTPKTDAILTLPPPLPILTRDNQ
TLNVNTTKIPTVFTQNVTVQGAPFLWLYLGSNRQKAGYTGGSGTTVLTFVYTVAEDDYTT
DLEYVDHHSLDASADGTAILHFSTNPTTLANLDLPYPLTDGSLSSNKNLTINGRKPRVVS
TTFLSADGRYDVGQKVLVRVIFSSCVTVVPNSVNQSVPRLRFKPSRTTMQPIIRYGVYTS
GSPGTNLSFEYTVQTGDTSSDLDYDDTTAIELNGARILTCTANPVATPPTQNVDIHLNPP
GGRLLGSNIQSIVFGRALFTDLMVNRLGFRYRIEFETQYGDAILQASSYFDVLYSAGYGL
RSNPSAIGDGLGACVDVDGDTLVMGAPGTKLPASAVQIVTVTGDAAAVTREANTYCGCRN
GFVWRITFLYVEGVLPALEGVSALTGRGASVGNERGGSFATIAVESTVIRGFFTLKLANR
VTRNIDYNVDEGNLSAILTQDLGLLVRSVSRSAPSGMESYTWQITFIASNAMYDVPQLDV
QTAGLRGYGASCAVYTIRDGQGRVSGSFRLRFRNDIFPNDETANIPVDASDQAVESALES
LVSIVDVKVARSASMNDFGGYSWTITFVKVNTKNEFGPILDTSSTLPALVAVTSVPQVGG
GTTFLLNGTNARVIVEVGGYDLVPDSEGKSFWGFAGDRAGMAAVFIRAENDWKQQGGTLV
GVDTREGDLFGSSVSIKGDLLLVGAPAAVSFGSFERQHFLCNADGGYFRIAFEGQQSAPI
AFNATPVANALLNAIVGVTSLSFSDVEVVVPVGATMCGQVEIEIVLKSGDIADESGNVPE
LTVDTKGLTRTVGGVTVPGNAYIQEYSAGTYRTDGAEAKGLQCGAAYMFARTSRVWAQVA
KLSPPPAQIADIQEYGASVSVINTYAAIGAPGAYEEEGRVFVYQWSGGSSAWILFQTLSA
APFSKSEGDRFGHAVSISQSQSGIITLAVGAPGYSAASGAVFVFDLLNSYFQNRQLILLP
SSNLAAGDRFGSSLDLDMATTFTLVVGAERNAYRDGVNSGVALVFTRRSSTDTFFTLQQV
LFGSDTRRQDRFGSSVAISKDTVLIGAHENYDGKRTIRKAVQSFSTGAFGGSDGNSQLIG
GLFMLGLVDANITASAAAGTGLRRIQTRTIPFDIDAASLKPILESDLPLGRVTVSREGPG
ADKGYTWYVTFIEATSDLPLLDIDGEYLLASIGATARVSSEWVVRVPPVLRSNAYLFTRD
DVGVWTEQATLFPRGKQYFAWFGSFVALDGRTAVVGAPNLDTYVSSVNSGGGFVFDIRIL
SLGFSKKSYSVLEGGSIDLKVQRCSVDGGFCAIDTTNAPQLFVNYDTGDAYSDRRSANYV
PVEPHVGPYQKLSMLDAVPFSAGAFYAADVVGQEPYPQVARGRWLVASHVGSATGRNQYY
GSTDRRSLWIDSQFDYAGVSDYASSSDELFFDAMDMTRTFRVDTTDDMVLEVPDETIVAR
LSLPGIWPSSKGRLWSTITITDNGDGGSGTRSSLEFLTADDDHVQSHSHFGAAVAIFDDG
NVAIVGAPLETTPMGVTRTAVDCGAAYIYVRRSGFWELDKRVTPSTCSPAMRFGASVGID
GSLGTIRAIVGAPGAPAAFIYRRDVVNGIVSWAEEIRLSDAAATSVAHNFGGSHSVGIFG
DIAVVGASGLERAFVYHHGLANWELATVLRSGDRRVVRVLQEDVEQTYAFGHAVALDGRT
VAIGAPFSDGGAFSAEEYHDRRFDRSYFGAGAVYVYHLPAQAQTVALRTDAPLVSGSFCL
TVTYRGVTATSRPIYYNSTAAFVQAAVQELGAIRLVETSRTGSVEQGFTWGVTFVGEVLQ
VPLLTATWLGNGCAGCDAFNTSYQADPTRQVLVSEKRSLGAWAQQGRLVAPDGNAGDQFG
ASVALSGEQVVVGAARSSALTTTSWDFETGDLTGWQTTGTAFDVQPTFGDNARARTNDYG
ALGPRSEGAGPRAGHEGRYWVGTFEARAGAGKTTAEIGTCSFASDALCRANAYTLPGLTA
AGTTQGDGPQGTLTSQAFVIRGPWLSFRVGGGCDDRVLFVELLVDGASVRRTTGQCMETM
RVVVWALHAEWQQRPARLRVVDASSSDFWGHLNFDDVRFAWDSVEQASMTLAGAAYTFRR
HAPASRDSCVAMDRSTCEWEFQSRLIASDLRSEDLFGWRVAVDEASGLAAVAAPGQHAVD
ANNSALVDGAGNELAEVGSVYMFRRIDEFPRKQAQARMGSALAMDGRSLLVGAPWKSPTP
ATPFAGQAFVYDAALATVAFTASEFSCLEGNTDRVVSLTLARSGGNMSEPLTIGFATEDR
SAVGVDALKFAACMKIPATERRDCFDYQQLAGELTFAAGETAKQLLVPVVDNTCQEPWAE

Enzyme Prediction     

EC	3.2.1.80:2	3.2.1.26:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM38	3926	4103	2e-19	0.9612403100775194

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407574	GCP_N_terminal	8.73e-84	482	783	1	294	Gamma tubulin complex component N-terminal. This is the N-terminal domain found in components of the gamma-tubulin complex proteins (GCPs). Family members include spindle pole body (SBP) components such as Spc97 and Spc98 which function as the microtubule-organizing center in yeast. Furthermore, family members such as human GCP4 (Gamma-tubulin complex component 4) have been structurally elucidated. Functional studies have shown that the N-terminal domain defines the functional identity of GCPs, suggesting that all GCPs are incorporated into the helix of gamma-tubulin small complexes (gTURCs) via lateral interactions between their N-terminal domains. Thereby, they define the direct neighbors and position the GCPs within the helical wall of gTuRC. Sequence alignment of human GCPs based on the GCP4 structure helped delineate conserved regions in the N- and C-terminal domains. In addition to the conserved sequences, the N-terminal domains carry specific insertions of various sizes depending on the GCP, i.e. internal insertions or N-terminal extensions. These insertions may equally contribute to the function of individual GCPs as they have been implied in specific interactions with regulatory or structural proteins. For instance, GCP6 carries a large internal insertion phosphorylated by Plk4 and containing a domain of interaction with keratins, whereas the N-terminal extension of GCP3 interacts with the recruitment protein MOZART1.
398000	Spc97_Spc98	9.91e-66	786	1063	1	255	Spc97 / Spc98 family. The spindle pole body (SPB) functions as the microtubule-organising centre in yeast. Members of this family are spindle pole body (SBP) components such as Spc97 and Spc98 that form a complex with gamma-tubulin. This family of proteins includes the grip motif 1 and grip moti 2. Members of this family all form components of the gamma-tubulin complex, GCP.
316802	FG-GAP_2	2.71e-09	3882	3914	1	33	FG-GAP repeat.
397326	Calx-beta	1.19e-06	4277	4371	3	76	Calx-beta domain.
316802	FG-GAP_2	4.99e-05	3055	3093	1	39	FG-GAP repeat.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRW20719.1|CE4	8.81e-32	469	1046	62	819
BAW95206.1|CBM38	1.20e-27	3926	4120	70	223
QEG43366.1|CBM38|GH32	3.07e-20	3914	4132	20	196
QDT04708.1|CBM38|GH32	3.27e-15	3926	4133	36	203
QVL32033.1|CBM38	2.36e-13	3926	4143	37	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7AS4_A	3.54e-151	432	1053	173	774	Chain A, Gamma-tubulin complex component 2 [Homo sapiens],7AS4_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7AS4_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7AS4_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7AS4_M Chain M, Gamma-tubulin complex component 2 [Homo sapiens],7QJ0_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ1_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ2_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJ2_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ3_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ3_M Chain M, Gamma-tubulin complex component 2 [Homo sapiens],7QJ4_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJ4_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ4_M Chain M, Gamma-tubulin complex component 2 [Homo sapiens],7QJ5_A Chain A, Gamma-tubulin complex component 2 [Homo sapiens],7QJ5_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJ5_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJ5_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ5_M Chain M, Gamma-tubulin complex component 2 [Homo sapiens],7QJ6_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJ6_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJ6_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ7_A Chain A, Gamma-tubulin complex component 2 [Homo sapiens],7QJ7_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJ7_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJ7_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ8_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJ8_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJ8_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJ8_M Chain M, Gamma-tubulin complex component 2 [Homo sapiens],7QJ9_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJ9_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJ9_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJA_A Chain A, Gamma-tubulin complex component 2 [Homo sapiens],7QJA_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJA_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJA_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJB_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJB_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJB_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJB_M Chain M, Gamma-tubulin complex component 2 [Homo sapiens],7QJC_A Chain A, Gamma-tubulin complex component 2 [Homo sapiens],7QJC_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJC_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJC_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJC_M Chain M, Gamma-tubulin complex component 2 [Homo sapiens],7QJD_A Chain A, Gamma-tubulin complex component 2 [Homo sapiens],7QJD_C Chain C, Gamma-tubulin complex component 2 [Homo sapiens],7QJD_E Chain E, Gamma-tubulin complex component 2 [Homo sapiens],7QJD_G Chain G, Gamma-tubulin complex component 2 [Homo sapiens],7QJD_M Chain M, Gamma-tubulin complex component 2 [Homo sapiens]
6TF9_RP1	3.93e-149	433	1045	173	765	Chain RP1, Gamma-tubulin complex component 2 [Xenopus laevis],6TF9_YP1 Chain YP1, Gamma-tubulin complex component 2 [Xenopus laevis],6TF9_ZP1 Chain ZP1, Gamma-tubulin complex component 2 [Xenopus laevis],6TF9_aP1 Chain aP1, Gamma-tubulin complex component 2 [Xenopus laevis],6TF9_bP1 Chain bP1, Gamma-tubulin complex component 2 [Xenopus laevis]
6V6B_C	4.58e-148	432	1053	173	802	Structures of GCP2 and GCP3 in the native human gamma-tubulin ring complex [Homo sapiens],6V6S_A Structure of the native human gamma-tubulin ring complex [Homo sapiens],6V6S_C Structure of the native human gamma-tubulin ring complex [Homo sapiens],6V6S_E Structure of the native human gamma-tubulin ring complex [Homo sapiens],6V6S_G Structure of the native human gamma-tubulin ring complex [Homo sapiens],6V6S_M Structure of the native human gamma-tubulin ring complex [Homo sapiens],6X0V_F Structure of MZT2/GCP-NHD and CDK5Rap2 at position 13 of the gamma-TuRC [Homo sapiens]
6TF9_QP1	8.38e-41	478	1018	246	763	Chain QP1, Gamma-tubulin complex component 3 homolog [Xenopus laevis],6TF9_cP1 Chain cP1, Gamma-tubulin complex component 3 homolog [Xenopus laevis],6TF9_dP1 Chain dP1, Gamma-tubulin complex component 3 homolog [Xenopus laevis],6TF9_eP1 Chain eP1, Gamma-tubulin complex component 3 homolog [Xenopus laevis],6TF9_fP1 Chain fP1, Gamma-tubulin complex component 3 homolog [Xenopus laevis]
6V6B_B	3.12e-39	478	1033	247	778	Structures of GCP2 and GCP3 in the native human gamma-tubulin ring complex [Homo sapiens],6V6S_B Structure of the native human gamma-tubulin ring complex [Homo sapiens],6V6S_D Structure of the native human gamma-tubulin ring complex [Homo sapiens],6V6S_F Structure of the native human gamma-tubulin ring complex [Homo sapiens],6V6S_H Structure of the native human gamma-tubulin ring complex [Homo sapiens],6V6S_T Structure of the native human gamma-tubulin ring complex [Homo sapiens],6X0U_B Structure of MZT1/GCP3-NHD and MZT1/GCP6-NHD in the gamma-TuRC lumenal bridge [Homo sapiens],7AS4_3 Chain 3, Gamma-tubulin complex component 3 [Homo sapiens],7AS4_B Chain B, Gamma-tubulin complex component 3 [Homo sapiens],7AS4_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7AS4_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7AS4_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7AS4_N Chain N, Gamma-tubulin complex component 3 [Homo sapiens],7QJ0_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ0_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ1_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ1_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ2_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJ2_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ2_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ2_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJ3_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ3_N Chain N, Gamma-tubulin complex component 3 [Homo sapiens],7QJ3_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ3_n Chain n, Gamma-tubulin complex component 3 [Homo sapiens],7QJ4_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJ4_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ4_N Chain N, Gamma-tubulin complex component 3 [Homo sapiens],7QJ4_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ4_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJ4_n Chain n, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_B Chain B, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_N Chain N, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_f Chain f, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJ5_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJ6_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJ6_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJ6_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ6_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ6_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJ6_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJ7_B Chain B, Gamma-tubulin complex component 3 [Homo sapiens],7QJ7_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJ7_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJ7_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ7_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ7_f Chain f, Gamma-tubulin complex component 3 [Homo sapiens],7QJ7_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJ7_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJ8_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJ8_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJ8_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ8_N Chain N, Gamma-tubulin complex component 3 [Homo sapiens],7QJ8_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ8_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJ8_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJ9_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJ9_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJ9_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJ9_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJ9_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJ9_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJA_B Chain B, Gamma-tubulin complex component 3 [Homo sapiens],7QJA_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJA_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJA_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJA_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJA_f Chain f, Gamma-tubulin complex component 3 [Homo sapiens],7QJA_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJA_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJB_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJB_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJB_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJB_N Chain N, Gamma-tubulin complex component 3 [Homo sapiens],7QJB_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJB_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJB_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_B Chain B, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_N Chain N, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_f Chain f, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJC_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_B Chain B, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_D Chain D, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_F Chain F, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_H Chain H, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_N Chain N, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_a Chain a, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_f Chain f, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_h Chain h, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_j Chain j, Gamma-tubulin complex component 3 [Homo sapiens],7QJD_n Chain n, Gamma-tubulin complex component 3 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9BSJ2|GCP2_HUMAN	1.82e-150	432	1053	173	774	Gamma-tubulin complex component 2 OS=Homo sapiens OX=9606 GN=TUBGCP2 PE=1 SV=2
sp|Q5R5J6|GCP2_PONAB	2.47e-150	432	1053	173	774	Gamma-tubulin complex component 2 OS=Pongo abelii OX=9601 GN=TUBGCP2 PE=2 SV=1
sp|Q921G8|GCP2_MOUSE	5.65e-149	433	1053	174	774	Gamma-tubulin complex component 2 OS=Mus musculus OX=10090 GN=Tubgcp2 PE=1 SV=2
sp|Q9C5H9|GACP2_ARATH	7.63e-116	428	1038	4	604	Gamma-tubulin complex component 2 OS=Arabidopsis thaliana OX=3702 GN=GCP2 PE=1 SV=1
sp|Q95ZG3|SPC97_DICDI	1.46e-108	433	1058	374	1081	Spindle pole body component 97 OS=Dictyostelium discoideum OX=44689 GN=spc97 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000066	0.000002

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000020936-p1.