CAZyme Information: EPrPVT00000020209-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000020209-p1
• CAZy Family: GH5
• CAZyme Description: AlphaN-acetylglucosamine transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
667		75865.33	6.7847

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0489:1620-4226(-)

Full Sequence      

QATLARAPASNLSAATQTFAEENNVATASDFIPNTPAQGHLISRLRVPTSQQPSVSTDHK
RYAYMFYATCDTYACAALQAMDHLVNRLDMDTTAIELVMLHTDGVSRHLLNKMTNRLDTR
TIRVDSIYADALDPTWFLSLTKLRTFQEWGYDRVVYLDADSFPLANLDHLFDLPPRRLYA
PTAYWLPQPFVSTSLMVIEPNNSVFDELIDWTRARGADAGYDMDVINSFFAASVVHLSGV
YTILNSDFRRAPNAQSPIFRTTAELKTYGMLVHFSCMPDGEYGKPWHWPSHDLSLLDGAG
FDPLFGEMMHRTASNTIGSAPALTKLGDGYNRRDFARYRSQRVLQLLFVLTVAVAILEWI
DLTKMASSEERPMAMRHSAASHLLKSPRQAQRRNVTDATDGQARKRFAYMFYATSNVYAC
AALQFMDRLVNRFDMDTTRIDLAVLHTDEVSPIFLAKMHERLNARTISVAAIDADARNPT
WLHSLTKLRAFQEWGYDRVVYVDADSTPMANLDHLFDAPPAPLYAPSAYWLHQPFIASTL
MVIEPSNSTFDAMIAWARKRGAAAKYDMDIINVFLKDQVIHLPGEYTVLSQDFRLTSWAR
PKLFRTTRELWARAKLVHFSCGPDGRYGKPWLWPSRKLSLLATWAFDPFFGEMFEDYWRG
EHELCDV

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	399	632	1.6e-24	0.9066147859922179
GT8	57	287	2.3e-20	0.8949416342412452

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133064	GT8_GNT1	4.50e-41	407	667	1	270	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133064	GT8_GNT1	8.84e-34	62	308	1	260	GNT1 is a fungal enzyme that belongs to the GT 8 family. N-acetylglucosaminyltransferase is a fungal enzyme that catalyzes the addition of N-acetyl-D-glucosamine to mannotetraose side chains by an alpha 1-2 linkage during the synthesis of mannan. The N-acetyl-D-glucosamine moiety in mannan plays a role in the attachment of mannan to asparagine residues in proteins. The mannotetraose and its N-acetyl-D-glucosamine derivative side chains of mannan are the principle immunochemical determinants on the cell surface. N-acetylglucosaminyltransferase is a member of glycosyltransferase family 8, which are, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed, retaining glycosyltransferases.
133018	GT8_Glycogenin	7.03e-24	407	633	1	214	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
133018	GT8_Glycogenin	1.14e-21	62	288	1	214	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
132996	Glyco_transf_8	1.35e-12	479	631	78	244	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIG55795.1|GT8	1.23e-36	405	665	118	369
AEO59372.1|GT8	1.32e-28	399	665	49	325
QGI78920.1|GT8	6.04e-27	406	667	55	336
QGI61733.1|GT8	6.04e-27	406	667	55	336
QGI92632.1|GT8	6.04e-27	406	667	55	336

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6MW5_A	1.02e-13	405	644	6	252	UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Platinum [Globisporangium ultimum],6MW8_A UDP-galactose:glucoside-Skp1 alpha-D-galactosyltransferase with bound UDP and Manganese [Globisporangium ultimum]
3Q4S_A	2.23e-10	63	288	6	223	Crystal Structure of Human Glycogenin-1 (GYG1), apo form [Homo sapiens],3QVB_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP [Homo sapiens],3U2W_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens],3U2W_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and glucose or a glucal species [Homo sapiens]
3T7M_A	4.02e-10	63	243	6	190	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7M_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a triclinic closed form [Homo sapiens],3T7N_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7N_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese and UDP, in a monoclinic closed form [Homo sapiens],3T7O_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3T7O_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP-Glucose and glucose [Homo sapiens],3U2U_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2U_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltotetraose [Homo sapiens],3U2V_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2V_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and maltohexaose [Homo sapiens],3U2X_A Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens],3U2X_B Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese, UDP and 1'-deoxyglucose [Homo sapiens]
6EQJ_A	4.02e-10	63	243	6	190	Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant, apo form [Homo sapiens],6EQL_A Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens],6EQL_B Crystal Structure of Human Glycogenin-1 (GYG1) Tyr195pIPhe mutant complexed with manganese and UDP [Homo sapiens]
3U2T_A	5.03e-10	63	243	27	211	Crystal Structure of Human Glycogenin-1 (GYG1) complexed with manganese [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q4WBL2|GNT1_ASPFU	2.81e-23	406	648	79	345	Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gnt1 PE=3 SV=1
sp|Q4HVS2|GNT1_GIBZE	4.62e-22	406	632	154	393	Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GNT1 PE=3 SV=2
sp|Q9Y761|GNT1A_KLULA	6.94e-10	58	185	92	225	Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=GNT1-A PE=3 SV=1
sp|H2KYQ5|GYG1_CAEEL	3.41e-09	63	287	4	220	Glycogenin-1 OS=Caenorhabditis elegans OX=6239 GN=gyg-1 PE=1 SV=1
sp|P46976|GLYG_HUMAN	4.28e-09	63	243	5	189	Glycogenin-1 OS=Homo sapiens OX=9606 GN=GYG1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999388	0.000649

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000020209-p1.