CAZyme Information: EPrPVT00000020078-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000020078-p1
• CAZy Family: GH5
• CAZyme Description: Chitin synthase (Chitin-UDP-GlcNac-transferase)

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
944		105549.09	6.8976

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0473:12735-15569(-)

Full Sequence      

MSGESRATNASPPLPPRSIGLGLAHALGLPPLSSAASHAGHSAMPRSTLMSVDYDGISLP
PASMRSCGSQQYVASAIPTSSPFQPASLHDMISSMRSYASATDLVRTYSEIPSVEEALAV
LERAAQALKARRYRDALKLYLEGGYALANVAERQANPKICNLLTSKGFEMLNWCGRLCDW
IEGRVKEKSPRPGVHKVGIPIVNWDEDWVGPFLDEEEARRLWYTPVYCPHPIDFSNAGYR
LRCVEMQRRPRLMICITLYNEGPQQLKKTLHKLANNLAYLQQRHQAPTAADGKAALASAF
HGDEVWKNVLVCIVADGRENINDKMLDYLEAIGLYDEDLLTINSAGIDAQVHLFEHTLQL
SAKNKSLLPIQAVFALKERRASKLDSHHWYFNAFAEQIQPEYTAVLDVGTMLTKAAIFHV
LCSFETNRQLGGACGQLAVDEPLKNLSNWVVSAQHFEYKISNLLDKSLESCFGYISVLPG
AFSAYRYEAIRGAPLDAYFQTLNVDLDVLGPFIGNMYLAEDRILGFEMLARQGCNWTMHY
VKDAVARTDVPDDLVSLIAQRRRWLNGAFFATVFSIWNWGRVYSESSHSVPRKIALFVLY
VYNLIYTVFGFFLPANVYLALYFIVFQGFQQNRWVFLDTSDYSQTVLNASVYLFNLVYLF
GIITLLIIGLGNNPKHMKLTYYFVAAVFGAVMMLSSLVGLGIFFSSPATVHSVVVSVLTI
GVYFIGAAIHGDLHHIFMTFTHYTALIPTFVNIFTVYSFCNLQDLSWGTKGLVEEPPLSP
LDEVEKGDFQDVIAKRRAMEERRREAQVRQDAKKKHFEAFRTNVLLTWAFGNLILSLFVV
YFASADTFMPVLYVFVAAINSVRLLGSIGYWIYEHTPGLRARVIDKSALGNGNGRYPQSN
VLQLDEHYAALAEDQRVYYASSRPGPLSSAIDEQESTDGISALV

Enzyme Prediction     

EC	2.4.1.16:26

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	258	424	1e-48	0.9938650306748467
GT2	401	626	3.1e-22	0.4155597722960152

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133033	Chitin_synth_C	2.02e-65	254	571	1	244	C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin. Chitin synthase, also called UDP-N-acetyl-D-glucosamine:chitin 4-beta-N-acetylglucosaminyltransferase, catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of GlcNAc residues formed by covalent beta-1,4 linkages. Chitin is an important component of the cell wall of fungi and bacteria and it is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases. Studies with fungi have revealed that most of them contain more than one chitin synthase gene. At least five subclasses of chitin synthases have been identified.
396286	Chitin_synth_1	3.45e-58	258	424	1	163	Chitin synthase. This region is found commonly in chitin synthases classes I, II and III. Chitin a linear homopolymer of GlcNAc residues, it is an important component of the cell wall of fungi and is synthesized on the cytoplasmic surface of the cell membrane by membrane bound chitin synthases.
224136	BcsA	5.24e-22	391	704	129	419	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
367353	Chitin_synth_2	1.52e-18	401	566	203	372	Chitin synthase. Members of this family are fungal chitin synthase EC:2.4.1.16 enzymes. They catalyze chitin synthesis as follows: UDP-N-acetyl-D-glucosamine + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N) <=> UDP + {(1,4)-(N-acetyl-beta-D-glucosaminyl)}(N+1).
133045	CESA_like	5.27e-14	373	491	56	167	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARC77249.1|GT2	0.0	28	936	3	911
ARC77251.1|GT2	0.0	28	936	3	911
ARC77250.1|GT2	0.0	28	936	3	911
ARC77247.1|GT2	0.0	15	923	5	898
ARC77246.1|GT2	0.0	15	923	5	898

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2MPK_A	5.56e-13	113	181	3	71	Characterization and structure of the MIT1 domain of a chitin synthase from the Oomycete Saprolegnia monoica [Saprolegnia monoica]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48017|CHS_SAPMO	6.03e-128	84	825	93	789	Chitin synthase OS=Saprolegnia monoica OX=37553 GN=CHS PE=3 SV=1
sp|Q99126|CHS3_USTMA	1.01e-110	215	870	333	1021	Chitin synthase 3 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS3 PE=3 SV=2
sp|P87073|CHS1_PHYB8	2.71e-110	211	874	128	837	Chitin synthase 1 OS=Phycomyces blakesleeanus (strain ATCC 8743b / DSM 1359 / FGSC 10004 / NBRC 33097 / NRRL 1555) OX=763407 GN=chs1 PE=3 SV=1
sp|P30595|CHS2_RHIOL	8.00e-108	211	874	145	854	Chitin synthase 2 OS=Rhizopus oligosporus OX=4847 GN=CHS2 PE=3 SV=1
sp|Q99127|CHS4_USTMA	3.47e-107	213	872	242	935	Chitin synthase 4 OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=CHS4 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999922	0.000118

TMHMM  Annotations     

Start	End
604	626
646	668
683	705
712	729
739	761
819	841
851	873