CAZyme Information: EPrPVT00000019779-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000019779-p1
• CAZy Family: GH47
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
676		74814.34	4.4620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0440:2500-4705(-)

Full Sequence      

MLLLESSRAWAVTAALWLTVGASRAANASDYELFGPLSTSAPPSSLIPYTDEHQTFLPPN
YAHSSRVYGGSTGNSDAYQYYLADLVDDFQFSATEFYTFPSFEIFDWDDLGVSVRYTNKH
GKYESTLVSGMAFATAKYTTLTPNILTVHQITAINGQTASSGLATNDDRFVLTLDNGQTW
ALYFSESVELELSGSSTLVGTSAFTGTMRLAYIPDPARLDTFDVASTCILEGGSVEATSE
SAYSFNWKTNGSCESGLLHYAQPHHLETLDPSTVELAAGITAYSTTRGQMQALVTTTSPP
VWQFEETLSIPVDFYPPRQPSASDVAEQNLLDTLTIDISSNWSIDVNGSYYFNGKAAQKY
ASLCLIANDSSVVGDDDSLLTTCLTKLRTVLAPFIHNSWGYPLNYDTVYRGILSSQGFAT
DNQFADFGNTMYNDHHYHFGYWIVTAAIVNKLDPTWSDIKALNTMADLLVRDVANPSWDD
TYFLRXXXXGHSYSHGVTPFPNGKDEESTSEDINFHYGLALYGQVRGNTELATIGKLMVK
LNARAIQTYFLMTDSNTVHPPSIIANKVTGIFFDNKVNYATWFTGHKYAIHGIQMLPISP
ITEFVRSKEFVTEEWEQVLSKDEIIVNNTMTNAWTSILYANYATVDKATAMEKLQNATMD
DGLTRSWALYMAATRP

Enzyme Prediction     

No EC number prediction in EPrPVT00000019779-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	55	670	1.1e-160	0.8987138263665595

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.73e-141	334	669	18	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.46e-126	64	673	134	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.70e-36	47	313	52	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29875.1|GH81	4.34e-243	48	676	145	793
UIZ20868.1|GH81	1.06e-225	43	674	145	791
UIZ20872.1|GH81	4.28e-225	43	674	145	791
UIZ20873.1|GH81	4.28e-225	43	674	145	791
UIZ20875.1|GH81	4.28e-225	43	674	145	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.45e-108	80	676	106	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	4.42e-108	80	676	131	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.32e-103	80	676	106	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	2.09e-25	87	650	87	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	9.88e-18	162	663	185	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.66e-92	117	673	135	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	6.36e-84	108	673	168	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|D4AZ24|ENG1_ARTBC	9.18e-82	127	673	342	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.15e-76	43	669	456	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	7.44e-74	64	673	504	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000293	0.999660	CS pos: 25-26. Pr: 0.9818

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000019779-p1.