CAZyme Information: EPrPVT00000019778-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000019778-p1
• CAZy Family: GH47
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
712	PvexDAOMBR484_SC0440|CGC1	77326.90	5.8974

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0440:5375-7592(-)

Full Sequence      

MKLSALGRALLSAATLSLAVGVSSAADNSTVADISEFELFEALSTGAPPSTLVPSTSAHS
SFLPPKFLASGIVGSRAIPTNNWWGNMIAYTTDSAVQPAWANPYTVRPQVSSPFGLAFSY
AYPSRAFGGSTGNSGAYQYYLHGSVNDFIISASEFTTIPTFEIFDWDDLSVSVRYTNSIG
KYESTLVSGMAYATAKFTTLTPNIQTVYAVLTINGNTASSGLATTGTRFVLTLNNGQTWT
LYFSTSVTLTLSGTSTLIGSSKLTGTMRLAYIPNTAQQSVFDASATCILDGGSVEAKDEN
TYAYNWETSGTCTSGLLHYAQPHHVDTLVASTAKVATGITAYSTTRGLMKALLTLTSPPV
WQFTDSTSIPVDFYPPRKPAASVVSAQNMLATLKSDINADWSIAVDGSYYFNGKAAQKYA
SLCLIANDASVVGTDTSILTTCLTKLRSGFTTNNMDADFGNTMYNDHHFHYGYWIVTAAI
VNKLDPTWSGITALNTMTDLLVRDVANPSWDDTYFVKFRNFDWYRGHSYSHGVTPFADGK
DEESSSEDMNFHYGLALYGQIRGDTQLATIGKLMVKLNARAIQTYFLMTDSNTVHPSTII
PNKVPGILFDNKADYATWFSGEKYAIHGIQMIPISPITEFVRTKEFVSQEWTQVLSKISI
IVNNDLTNAWTSLLYANYATVDKTTAMTKLQTATMDDGLTRSWALYMAATRP

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	74	706	4.6e-169	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	1.14e-137	12	709	30	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	5.39e-136	389	705	10	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	1.90e-48	63	372	3	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29875.1|GH81	2.02e-271	30	712	69	793
UIZ20868.1|GH81	6.25e-245	48	710	90	791
UIZ20872.1|GH81	1.25e-244	48	710	90	791
UIZ20875.1|GH81	1.25e-244	48	710	90	791
UIZ20873.1|GH81	2.52e-244	48	710	90	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.15e-94	76	712	39	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.97e-94	76	712	64	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	9.39e-90	76	712	39	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	4.09e-31	48	686	15	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	3.00e-19	462	699	436	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	9.79e-95	58	709	20	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.83e-77	39	705	402	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.38e-76	78	709	226	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	4.53e-72	66	709	86	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	7.97e-71	38	709	427	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000367	0.999568	CS pos: 25-26. Pr: 0.9438

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000019778-p1.