CAZyme Information: EPrPVT00000019673-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000019673-p1
• CAZy Family: GH43
• CAZyme Description: Chitobiosyldiphosphodolichol beta-mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437		48794.09	10.1279

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0428:6120-7869(+)

Full Sequence      

MRTRKGRTRPKPRVGGSGARHAVVLVLGDVGRSPRMQYHALSLARLAPERLRVSLAGHAG
ESCVPDIAAQANLDVVTFAPRMTRLPRGPLFAALAPVKALVQLVQLLWLLLVTVGRFDLV
LLQNPPTIPTFVVVWLCCRLRRAAFVATWVERVFGRKADANLCVTRVMQRWLRDTWQIEA
RVLHDKPPPFFRPTPLDVQHELWTRVGGQLAHCNDLVDWSAGADETLLTRKAVAHGKPLV
LPRDQRPAMIVSSTSWTADEDFGILLDALVSLDKRTSGLRLAEFPNLLVVVTGKGPQKEM
YLEKISRLAFKRIRIATMWLEASDYPLVLGSADLGVCLHTSSSGLDLPMKVLDMFGCGLP
VCAVGFQCLDELVHHDKNGLVFDTSEQLADQLFGLLKGYPRNTPQLDRLRVALQHVEHWA
ENWDRSAAPLFRKQLKL

Enzyme Prediction     

EC	2.4.1.142:10	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT33	145	429	1e-102	0.6517647058823529

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
340843	GT33_ALG1-like	5.63e-154	20	431	4	411	chitobiosyldiphosphodolichol beta-mannosyltransferase and similar proteins. This family is most closely related to the GT33 family of glycosyltransferases. The yeast gene ALG1 has been shown to function as a mannosyltransferase that catalyzes the formation of dolichol pyrophosphate (Dol-PP)-GlcNAc2Man from GDP-Man and Dol-PP-Glc-NAc2, and participates in the formation of the lipid-linked precursor oligosaccharide for N-glycosylation. In humans ALG1 has been associated with the congenital disorders of glycosylation (CDG) designated as subtype CDG-Ik.
215155	PLN02275	2.74e-144	20	396	5	371	transferase, transferring glycosyl groups
223515	RfaB	1.57e-10	66	397	36	341	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
340831	GT4_PimA-like	1.79e-09	24	425	2	363	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
340816	Glycosyltransferase_GTB-type	3.60e-07	251	382	114	235	glycosyltransferase family 1 and related proteins with GTB topology. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. The structures of the formed glycoconjugates are extremely diverse, reflecting a wide range of biological functions. The members of this family share a common GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ21318.1|GT33	9.33e-203	19	437	80	565
CCA25895.1|GT33	3.35e-146	21	430	11	446
CAG7866879.1|GT33	3.91e-122	22	430	8	455
VDC63845.1|GT33	3.91e-122	22	430	8	455
VDD58754.1|GT33	2.77e-121	22	437	8	462

PDB Hits     

EPrPVT00000019673-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8L7M0|TUN_ARATH	6.94e-117	22	430	7	454	UDP-glycosyltransferase TURAN OS=Arabidopsis thaliana OX=3702 GN=TUN PE=2 SV=1
sp|Q5R7A2|ALG1_PONAB	4.07e-101	2	430	25	460	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Pongo abelii OX=9601 GN=ALG1 PE=2 SV=1
sp|Q9BT22|ALG1_HUMAN	1.15e-100	16	430	29	460	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Homo sapiens OX=9606 GN=ALG1 PE=1 SV=2
sp|Q921Q3|ALG1_MOUSE	1.93e-97	19	430	32	460	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Mus musculus OX=10090 GN=Alg1 PE=1 SV=3
sp|P90522|ALG1_DICDI	3.67e-76	24	431	6	462	Chitobiosyldiphosphodolichol beta-mannosyltransferase OS=Dictyostelium discoideum OX=44689 GN=alg1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000046	0.000002

TMHMM  Annotations     

Start	End
90	112