CAZyme Information: EPrPVT00000019075-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000019075-p1
• CAZy Family: GH30
• CAZyme Description: Glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
318		34431.64	4.1866

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0363:23541-24631(-)

Full Sequence      

MRSLLELAALGVALLSGVRAETLCSTTPITYPGAKDEFVPARWPIDMLLKYGVATWVSDR
IVNGDASSTVQELVTSCPEDSRLSVVLYALPNKDCSAGFSNGNASIVTGDDYAAFVTELT
DLIGDRKVLYVLEPDAVGLIVSGGCAIESDYQGNLTTAVSLLSTNPNAEIYVDVGYWTLS
TNESAAQVAKVVKELSRNGTVKGITLNTSNYRPTPELVELCSNFQTAINSTDMHCIIDTS
RNYQSDDGYCTNQSSDALRGPEAGTFYYEHFIKLWNHGYFTIEQDNIRIFDESDSAATRW
SAPLISSLVVAIATLVVV

Enzyme Prediction     

No EC number prediction in EPrPVT00000019075-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	48	247	4.7e-36	0.7346938775510204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	2.36e-22	50	242	13	238	Glycosyl hydrolases family 6.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	2.34e-79	1	299	2	331
UIZ23641.1|GH6	3.52e-73	18	284	23	327
CCA16954.1|GH6	9.20e-69	19	297	19	336
AIG55947.1|GH6	6.35e-54	13	299	10	324
AIG55974.1|GH6	3.81e-53	20	284	22	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JX5_A	2.74e-18	35	242	37	237	GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_A GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102]
1DYS_A	1.28e-12	50	213	46	225	Endoglucanase CEL6B from Humicola insolens [Humicola insolens],1DYS_B Endoglucanase CEL6B from Humicola insolens [Humicola insolens]
1UP0_A	2.43e-11	56	242	43	221	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UP3_A	2.43e-11	56	242	43	221	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	2.81e-11	56	242	64	242	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7SIG5|GUN6_HUMIN	6.58e-12	50	213	46	225	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|P26414|GUNA_THEBI	7.00e-12	85	242	104	257	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P46236|GUNB_FUSOX	9.49e-12	86	211	182	321	Putative endoglucanase type B OS=Fusarium oxysporum OX=5507 PE=2 SV=1
sp|B2ADA5|GH6D_PODAN	5.33e-10	50	213	69	243	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|A2QYR9|CBHC_ASPNC	1.35e-09	86	302	181	426	Probable 1,4-beta-D-glucan cellobiohydrolase C OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=cbhC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000212	0.999779	CS pos: 20-21. Pr: 0.9772

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000019075-p1.