CAZyme Information: EPrPVT00000018878-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000018878-p1
• CAZy Family: GH30
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1660		185764.41	4.7533

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0345:1894-7094(+)

Full Sequence      

MRAVAVGVAASLALLRSPAADARGVNVNLTASWPSSPLFPLLETSEFLAEENPLYFWQFV
EDLQHETANIEKLDGDVDALSDLAVRVAQQINADSKNILELSLATRTYSVKVEMFRQLAL
DSNFHACGGDASAWALVYQEPQCVEAIACTADELEAILRGDQASERNNQTCLAVGVNDVE
LEDVDHKYPHLMPSPGSELPATAILYGLVGTPSFYSFHDKLVELAKTNELQYIVRHFAKD
STLETLLQGYGVALDIKNMEYKTIDDSKKTEEDEDTFDDDLEEDEEASVEEDDVDGLFFR
TLMDRHSAVSSELKAFHDQLIADHERDYEIKPWHLKELGISAAREVVDSKHPLRRLQSLS
QDFPLHAKKLAFSRKVIPDEFREEIQALRLQASRKQLLNKFLLNGIAVDPMQLSFNIFDF
MGTLKEEWSVAKKLGALPLTVEEREEMLDDVRAAKLSQPAVRIRVRGSESTTTPLYLNNI
ETDPTSEKWNNDLAAMTRPSWNLIFIRRNMYEYILALDPLTTSARETLTHIAFMRMRGAP
IQWGLLISSKELLSAKSEAERASLVKQWKEFESTEANATAWHFAKILMLAKFKDNAAAEA
LAAEALAAEEKSSDEGSLEGEDDEAPIQSRIVPTTTASGFLEGVSADTASETMSIEQLVE
AYVDATITGSRSENVDEVMEVLRGDRFDLDILAMTDFIQQKHLPFESSLFNGVLQKDIDV
QKTVMSHFGRDQPIYIDMVRRGVLTNDAEDVIEELLESQETYSAYLSIFDKDGGKLRGQA
PPPPSEHLLSKDVDGRLEQALSEYLPYLHAPGSLSVAKKQTVILPANLSDPVDAAHAYQL
VKAVVEDSEHELRVGIIPTNDDLSAGSMVVAVLAAVGNSDVEAHLRIVLDALQCVVRGKS
LEAAQAKLAWIVEKMKSNNEVASDDKIVKKISKIADQVQSKHPFEWVTDSQRSALRKLNA
LLETRFPRAHGSDETSEELSHLFLNGLRVTLPSHPLTGEDVATLTSYDMKYRTLPVAKAL
VKRNAKLSEGDASALSFEIIKTCGAVDQYLEAARTSKLQTSDAAANTVTLAGDPALAVVA
YVDPLSEAVQRMSSILSMLHHQLNATVELVLLPATDYAEFPLQRFYRYLFDKKHSHSAAK
IEFRKLPIQPILTMKIETPEAWNVQVQRASDDLDNLRVDPDSPADIRSTKSAVFHLQSLL
VYGQCYDTTFDMYAPPNGLQLVLNRELGTMKFHRDTLVMKNLGYFQLQATPGVWSLHLAR
GRASELFEIIDRKTGEKLKALDVTVHDFGSHISQLLVRKQEGKETEELLSEDDANSAKTS
ESEPIGSDAGVMNSYWNSMLSMLGREKSAKSDDLPTVQVEDTAAVVAGNAGAERTGETIH
VFSVASGFLYERFVKIMMSSVLKRTNNPVTFWLLENFLSPSFKSALPALRAELGMDIRLV
TYKWPNWLRQQTEKQRIIWGYKILFLDVLFPLGVRKIIYVDADQVVRADLRELWDMDLDS
APYAFTPFCDSRNVGFQFWRQGYWKDHLRGRPYHISALYVVDLARFRQMAAGDQLRAVYS
QLSADPNSLANLDQDLPNYAQHQIPIFSLPQEWLWCESWCSDETKAAAKTIDLCNNPKHK
EPKLDMAKRVIAGKLFNESWLELDSEIRDAEAGFGETKKA

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1379	1624	7.6e-124	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1379	1649	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	2.98e-165	1379	1624	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	5.46e-60	1379	1619	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
408199	Thioredoxin_12	1.25e-41	35	241	1	181	Thioredoxin-like domain. This is one of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).
399437	UDP-g_GGTase	1.48e-25	1203	1310	2	109	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	7	1654	10	1660
CCA14500.1|GT24	0.0	18	1651	31	1662
AIG56125.1|GT24	0.0	20	1654	23	1505
AIG55512.1|GT24	0.0	23	1654	24	1515
BBN16825.1|GT24	4.53e-207	21	1652	37	1599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TS2_A	7.00e-136	1079	1649	659	1212	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	2.11e-134	1079	1649	893	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	3.94e-134	1079	1649	893	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	3.94e-134	1079	1649	893	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6FSN_A	4.17e-115	1379	1649	17	283	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila],7ZHB_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila],7ZKC_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0WL80|UGGG_ARATH	8.87e-197	23	1648	31	1566	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q09332|UGGG_DROME	1.46e-180	1	1648	2	1505	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2
sp|Q9NYU1|UGGG2_HUMAN	5.00e-176	20	1648	30	1496	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4
sp|Q8T191|UGGG_DICDI	3.18e-174	21	1658	33	1644	Probable UDP-glucose:glycoprotein glucosyltransferase A OS=Dictyostelium discoideum OX=44689 GN=ggtA PE=1 SV=2
sp|Q6P5E4|UGGG1_MOUSE	6.58e-172	20	1654	42	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000270	0.999697	CS pos: 22-23. Pr: 0.9408

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000018878-p1.