CAZyme Information: EPrPVT00000018749-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000018749-p1
• CAZy Family: GH3
• CAZyme Description: Serine protease

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1550		168284.88	5.2848

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0331:11512-17353(-)

Full Sequence      

MARRRLSRPWRWRLPALLGCAAFSVAAPFATATVAAQEPLNMTVGSVQDARGLQFVDAAA
FCAFHCRETHLAAPSECSAARCSHFQRRLESNGSVDGYDVPEIDFLACRGVDTSGSEEAT
KLTLAVSQGATVSDVLARFHDAFFAAFDAMVASENSTADACQLQLLQDVLLPTVNDSDAE
TARQPMLVKLSSTLDDERACVQAIKAIWSDDDESLTPFLTRRGQRNAAATVMLLHVDGSV
AASIHALDCVDSVLELPAVLKLLPFARSTAQLSVITAGATDEFPSMEIRLIDGSDPAVVL
QRLQSAIQQWFGISNAFELPEASDHRPLSIFLKPLQELTTWSRAVALAVSDATVEWMDVR
VEVSANVLRGEPTLPMSRRLDEYVPSLVGVDSTRSAGIRGNDVIVGVTDSGLYLNHDQFD
QSTRAIFTSADMSARKVVYYNAWANDVDESDSVTCGHGTHVTGILAGSSWSGTSDDLGIA
DNARIAFMDIGAQSSSCAGKSGCGVQLATPAKAGDLVESQMGVGARIFSFSWGTPGSDYS
SQARDLDDFIYQNPDVLVVVAAGNSGESATTGTISSPSGAKNVISVGASLNAAASFSDVG
CSSVFNEYSVASFSSSGPTTDGRLKPDVVAPGMRLVSSQSEKPGSTTKTSATCSLQGTSQ
ATPVITGMAVLLFEWLRDGWWKDGTKNSEYGMTTVPAALLKALIIHSGEPLRRRLGPLGT
GFVSCGQVEKEASTLTTFPNVFQGYGKPNMSNLVEFGTANGSSPSLYFLPNSTAGSEPRV
AHNQEVIISFTVASGVDLRTTLVWTDPPGSVRSTTQLQHDLDLSVRLRNGTTSFYPVTAD
KTSRRDDTNNVEVVLVSYADLLAAATADNSSASAVGDAGELIVEAVIFGRSVLLADAQTF
AFRKEKKKERRRRQQRAATQGTAASHQVAGYPGVIAPYNQFLTPPAALVDVTAMGGDVTG
ERCPFCMFACADPVVMVNHVEHLHSNALPSSAAMGGDSTGVASVPVLEDGGLIMSGECTM
PPVERCPHCSFTTPDAVILVNHVEHPPAATVDKATIAAAEEHARHVKLLPMREKKTRRFR
CVGWRSTGECSPFGPRTPAGDQSCSRTVPPGESGYCEIEDKDSGERFRVMQLHCDSLLPT
ARFRCFEAWDFANLHIQARDAFLPALKPGYVLENIAPQPADQQLTDGIVMVVYPKLVPSA
YATIRALRAMGCSLPIEIWFRPDEIRSFPPALQLLNASFGPVTFRAIDYTRAVGFATKIH
ALMHSQFERVLFLDADNVPVRDPTYLFSTREFVETGAIFWPDFWHPGHSIFNVHAKSPLW
ELLDMPFVNMFEQESGQLLIDRRRHAAPLELVQFFTYHRPNHFERLKLVVNGSLFCGMTM
AQHDPAGDVLFLHRNSRKLLGAKEERPSKRMALTRRERKELRRQILARRGIVVPKSADQD
DPDDEDGEEDKVEEDKEDEDPLEADGLPDPIMWTHLFSFKRGASRKHYVVGIYKVPPFLP
ESQSCYGEARAFESNYFTLTAFADMPFASLENELRAFAHEAAQLDATGKW

Enzyme Prediction     

No EC number prediction in EPrPVT00000018749-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT71	1186	1363	1.6e-37	0.7765151515151515

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
173791	Peptidases_S8_Kp43_protease	1.90e-82	395	709	1	293	Peptidase S8 family domain in Kp43 proteases. Kp43 proteases are members of the peptidase S8 or Subtilase clan of proteases. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure (an example of convergent evolution). Kp43 is topologically similar to kexin and furin both of which are proprotein convertases, but differ in amino acids sequence and the position of its C-terminal barrel. Kp43 has 3 Ca2+ binding sites that differ from the corresponding sites in the other known subtilisin-like proteases. KP-43 protease is known to be an oxidation-resistant protease when compared with the other subtilisin-like proteases
395035	Peptidase_S8	1.59e-42	400	711	1	275	Subtilase family. Subtilases are a family of serine proteases. They appear to have independently and convergently evolved an Asp/Ser/His catalytic triad, like that found in the trypsin serine proteases (see pfam00089). Structure is an alpha/beta fold containing a 7-stranded parallel beta sheet, order 2314567.
173812	Peptidases_S8_1	2.83e-37	400	674	1	245	Peptidase S8 family domain, uncharacterized subfamily 1. This family is a member of the Peptidases S8 or Subtilases serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.
402574	Mannosyl_trans3	3.97e-30	1186	1384	2	273	Mannosyltransferase putative. This family is conserved in fungi. Several members are annotated as being alpha-1,3-mannosyltransferase but this could not be confirmed.
173801	Peptidases_S8_C5a_Peptidase	5.56e-29	397	678	7	294	Peptidase S8 family domain in Streptococcal C5a peptidases. Streptococcal C5a peptidase (SCP), is a highly specific protease and adhesin/invasin. The subtilisin-like protease domain is located at the N-terminus and contains a protease-associated domain inserted into a loop. There are three fibronectin type III (Fn) domains at the C-terminus. SCP binds to integrins with the help of Arg-Gly-Asp motifs which are thought to stabilize conformational changes required for substrate binding. Peptidases S8 or Subtilases are a serine endo- and exo-peptidase clan. They have an Asp/His/Ser catalytic triad similar to that found in trypsin-like proteases, but do not share their three-dimensional structure and are not homologous to trypsin. The stability of subtilases may be enhanced by calcium, some members have been shown to bind up to 4 ions via binding sites with different affinity. Some members of this clan contain disulfide bonds. These enzymes can be intra- and extracellular, some function at extreme temperatures and pH values.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28119.1|GT71	2.45e-87	1190	1544	1	357
UIZ24000.1|GT71	5.14e-77	1079	1544	104	570
UIZ27901.1|GT71	2.16e-76	1079	1407	70	427
CCA25306.1|GT71	6.33e-76	1081	1405	71	452
CCA25989.1|GT71	8.02e-75	1079	1398	96	459

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FAX_A	8.92e-39	397	856	18	403	Chain A, Subtilase SubHal from Bacillus halmapalus [Sutcliffiella halmapala],5FAX_B Chain B, Subtilase SubHal from Bacillus halmapalus [Sutcliffiella halmapala],5FBZ_A Chain A, Enzyme subtilase SubHal from Bacillus halmapalus [Sutcliffiella halmapala],5FBZ_C Chain C, Enzyme subtilase SubHal from Bacillus halmapalus [Sutcliffiella halmapala]
1WMD_A	8.19e-37	381	856	1	404	Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (1.30 angstrom, 100 K) [Bacillus sp. KSM-KP43],1WME_A Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (1.50 angstrom, 293 K) [Bacillus sp. KSM-KP43]
1WMF_A	2.71e-36	381	856	1	404	Crystal Structure of alkaline serine protease KP-43 from Bacillus sp. KSM-KP43 (oxidized form, 1.73 angstrom) [Bacillus sp. KSM-KP43]
3AFG_A	3.15e-14	380	688	119	387	Chain A, Subtilisin-like serine protease [Thermococcus kodakarensis],3AFG_B Chain B, Subtilisin-like serine protease [Thermococcus kodakarensis]
1C3L_A	1.52e-11	383	672	6	233	Subtilisin-Carlsberg Complexed With Xenon (8 Bar) [Bacillus licheniformis],3UNX_A Bond length analysis of asp, glu and his residues in subtilisin Carlsberg at 1.26A resolution [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8T9W1|TAGD_DICDI	5.12e-33	398	855	327	869	Serine protease/ABC transporter B family protein tagD OS=Dictyostelium discoideum OX=44689 GN=tagD PE=3 SV=1
sp|Q9GTN7|TAGA_DICDI	6.56e-33	375	856	264	802	Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum OX=44689 GN=tagA PE=1 SV=2
sp|P54683|TAGB_DICDI	2.01e-30	398	856	376	913	Serine protease/ABC transporter B family protein tagB OS=Dictyostelium discoideum OX=44689 GN=tagB PE=3 SV=2
sp|Q23868|TAGC_DICDI	1.91e-28	398	855	314	863	Serine protease/ABC transporter B family protein tagC OS=Dictyostelium discoideum OX=44689 GN=tagC PE=2 SV=2
sp|Q59KJ7|MNN21_CANAL	1.35e-14	1151	1363	208	469	Alpha-1,2-mannosyltransferase MNN21 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN21 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004918	0.995061	CS pos: 36-37. Pr: 0.9044

TMHMM  Annotations     

Start	End
12	34