CAZyme Information: EPrPVT00000018522-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000018522-p1
• CAZy Family: PL4
• CAZyme Description: TPR domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
758		84699.72	5.3349

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0309:24195-26746(+)

Full Sequence      

MAAGKPESLARAVPARLRSPRCHALWRCLGYVVAAAAATAIGAEEFDELPEFNDPLPGLS
LPVLEILHPPNSALLANTELSIEFVVRDGMLHGGLRDPRVCVSMQATFVPEDVQGPDHSW
VNELTETCFDQRLNFTSFNVNGLVAGVSYGVTVGLENQGKLAAISTRSFSVAAVRLTGVP
FVLSAPEALDEGVRSQRDGDPETAIRIYGYVLELFPEYAEAHHLMGIALVQQNRPEDALE
HLFQAVRGNDSDDNFHNSLGSALSTVGRLDEAIRHFRRALVLNPLCLQARVNLGDAVQQQ
GNWIEALKLYQEVVTRVSNADENTIAYELVKYAKDSSSRLCALRRQIDGWYPADRCLKHA
ISMWPDEPLFRHERGYLLLSAGQFEAALLEFQAAVDLGYSMAQVTPSTRRGSAFTGNHDN
MCALSDGVNCVQVSVADTLEALGETNASIVAYEQVMLGWDILSNEIADKFHPRTRVMVMK
ATVLPRILPSSQADIDIFRLRFEAEIDNLMANVHRLEETELDPIRIAFSTAVPMNAHNCN
NRVLKTKLGQLYHTLLHERPIVSELYVSSYAMSPQPYVQAERERLHNGIEIGPHRLRIGF
VSRFMFNAAVGLYMDELLPQLDYRKYDIIVFAIGQSKSMKSKEEMPQIAETIVALPKDLK
IVREQVMAWNVDVLVYPEVFRTVFSCLVLCLTARMCFRQLGMDKTTFFLSFSRLAPIQAA
WWGNADTTGIPAIDYFLASQYEDSGFKTHYSEEVYQFK

Enzyme Prediction     

No EC number prediction in EPrPVT00000018522-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
276809	TPR	2.77e-18	219	314	1	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
276809	TPR	1.19e-14	185	280	1	96	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
411346	social_mot_Tgl	5.43e-14	190	314	36	127	social motility TPR repeat lipoprotein Tgl. Social motility in delta-proteobacterial species such as Myxococcus xanthus depends on a type VI pilus, which in turn depends on assembly of the PilQ secretin complex. Tgl, a tetratricopeptide repeat (TPR) outer membrane lipoprotein, is required for PilQ assembly.
223533	TPR	1.28e-11	199	341	144	288	Tetratricopeptide (TPR) repeat [General function prediction only].
226428	Spy	1.99e-10	593	754	257	399	Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20641.1|GT41	4.39e-136	50	689	24	617
BAI76932.1|GT41	9.33e-24	365	754	64	439
BAP54338.1|GT41	2.07e-22	474	754	135	371
BAZ61948.1|GT41	5.08e-21	444	758	410	676
BAZ15802.1|GT41	5.08e-21	444	758	410	676

PDB Hits     

EPrPVT00000018522-p1 has no PDB hit.

Swiss-Prot Hits     

EPrPVT00000018522-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.963211	0.036789

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000018522-p1.