CAZyme Information: EPrPVT00000018500-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000018500-p1
• CAZy Family: GH3
• CAZyme Description: PNT1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
421	PvexDAOMBR484_SC0307|CGC1	48060.29	8.9062

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0307:14060-16033(+)

Full Sequence      

MQLAHALFTGALAVRLALIAYGHFQDEYMAVKYTDVDYDVYTDAARELAAGRSPFDRTTY
RYTPILAGLMLPNIFAMEAFGKLLFVACDLAVGYILFQFLRLRGQSENSAALYTCFWLFH
PFSINISTRGNADSIVALLVSLTLLLIVRKQLVWAALTYGAAVHFKIYPIVYALAFLVFL
DNDYNTANGISSMTCQSSDRFWLRLARFCNRDRVIFSLVSGGFFVLLTAAFYYLYDFQFL
YEAYLYHFTRTDNRHNFSVYFYDLYLRYNTRSGLTMGLLAFLPQMAALVAISLSYGRDLP
FALFALTMVFVAFNKVCTAQYFLWYTAFLPLILPLTTLRIKWKGLLMIAAWLGSELHWLF
WAYHLEMKGTNTFFPLWIAGLAFFAVNIGVLASLMRHHTFSPLFCDGKVVPLAPSGSKKQ
D

Enzyme Prediction     

No EC number prediction in EPrPVT00000018500-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	126	394	9.8e-93	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	1.26e-133	6	410	10	430	GPI mannosyltransferase
252941	Mannosyl_trans	3.83e-67	126	395	1	259	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA18245.1|GT50	2.41e-148	11	409	12	407
BBN20063.1|GT50	6.60e-116	14	407	46	440
VDC86084.1|GT50	1.50e-115	7	404	20	422
CAG7892072.1|GT50	1.50e-115	7	404	20	422
CBN81774.1|GT50	1.23e-113	7	398	14	400

PDB Hits     

EPrPVT00000018500-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q500W7|PIGM_ARATH	1.17e-112	6	404	20	434	GPI mannosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=PIGM PE=2 SV=1
sp|Q5EA10|PIGM_BOVIN	1.17e-108	8	403	22	416	GPI mannosyltransferase 1 OS=Bos taurus OX=9913 GN=PIGM PE=2 SV=1
sp|Q9H3S5|PIGM_HUMAN	4.69e-108	8	403	22	416	GPI mannosyltransferase 1 OS=Homo sapiens OX=9606 GN=PIGM PE=1 SV=1
sp|Q5RAH7|PIGM_PONAB	4.69e-108	8	403	22	416	GPI mannosyltransferase 1 OS=Pongo abelii OX=9601 GN=PIGM PE=2 SV=1
sp|Q4R4E1|PIGM_MACFA	1.33e-107	8	403	22	416	GPI mannosyltransferase 1 OS=Macaca fascicularis OX=9541 GN=PIGM PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.989427	0.010599

TMHMM  Annotations     

Start	End
7	24
74	96
135	157
161	180
214	236
273	295
302	324
344	361
373	395