CAZyme Information: EPrPVT00000018282-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000018282-p1
• CAZy Family: GH3
• CAZyme Description: GPI mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
435		48287.29	9.5632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0286:20734-22306(+)

Full Sequence      

MSEQQVVRFAAASRVAVSLLAALSAWLVTPYDSSSRLLAGGKSVGALAGFANWDGVYYVH
IARFGYEYEHFHAFFPFYPALVRLLSAALPLAPETAILVSGWFISNVSFVAAALYLYRLG
VLVLPDERVARRAAYLFSVAPSSIFMSAVYSESLMCLLSFSGMYYLEKDSAASTTSRAVP
SRNLIISAFLFGAASLTRSNGILLSFGCSLYIAWRRLLASPKPHTQPTLFLGYWVCTAML
GLVAIGPQIAYYVAGIVRYCPSLVGSVLGTEQGTVEDRSWCKDVVPNISAMYIFVQREYW
NVGVFRYYEWRQLPNFLLAAPMLALSVHSLASYFSDRWSRRKGLKKASSRRFGDAVAQYY
VHWLFLLVNALLVVHIQVTTRLLAACPPLFWHPAALGFAGQDMQSVTRYGTVVVGYFLLF
SVLGAVLFPTFYPWT

Enzyme Prediction     

No EC number prediction in EPrPVT00000018282-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	6	435	1.7e-104	0.9975429975429976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	6.88e-49	5	435	3	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	4.18e-16	50	339	71	325	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28864.1|GT76	3.41e-162	1	435	4	439
CCA18790.1|GT76	4.47e-115	3	435	6	490
BAF29832.1|GT76	1.48e-56	6	435	8	486
BAT17237.1|GT76	1.48e-56	6	435	8	486
BAG93531.1|GT76	1.48e-56	6	435	8	486

PDB Hits     

EPrPVT00000018282-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q7TPN3|PIGV_MOUSE	3.13e-38	2	408	7	429	GPI mannosyltransferase 2 OS=Mus musculus OX=10090 GN=Pigv PE=2 SV=2
sp|Q2GSI6|GPI18_CHAGB	5.92e-38	31	433	47	469	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q290J8|PIGV_DROPS	8.37e-38	46	435	59	452	GPI mannosyltransferase 2 OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=GA19757 PE=3 SV=1
sp|Q9NUD9|PIGV_HUMAN	3.83e-36	2	435	7	493	GPI mannosyltransferase 2 OS=Homo sapiens OX=9606 GN=PIGV PE=1 SV=1
sp|Q5KR61|PIGV_RAT	5.20e-36	2	408	7	429	GPI mannosyltransferase 2 OS=Rattus norvegicus OX=10116 GN=Pigv PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999651	0.000376

TMHMM  Annotations     

Start	End
7	29
44	66
73	92
102	124
144	166
186	208
229	251
313	335
356	378
412	434