CAZyme Information: EPrPVT00000017950-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000017950-p1
• CAZy Family: GH19
• CAZyme Description: Carbohydrate-binding protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	PvexDAOMBR484_SC0256|CGC1	39001.17	4.1319

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0256:26745-28137(-)

Full Sequence      

MDFRDERSAGAPPVHSASPARHVDAELVDSSYYYAPSSDMGPYLSSSLHQRLTPKTKRAS
GNGSGSSASTATAADSVSSSPALSSSSSSTGDCPTVAANDRTVVFWQSEVAGCDLLPKGV
THVIWGFALVADGSIVPTFQGADSTLIDCVQQLRAKCILSLGGIGGSTNNDNMTAVVDAA
TFAKSAVALVKKFDFDGLDLDDETVGSQFNSTRVVDLLQATRTELNAVNTSLLLTYDAYF
YEGQPSFCQDPDNIAYSRCFPTGVLAYVDWINIMAYNVNQANVTAEAVYAAAITSTFAAW
SEQLANDFSRATIGVCVADNCAYGPGPNATIIADWNDFARQDGYGGMMVYAASGEVADDF
PVTRSLIVVS

Enzyme Prediction     

EC	3.2.1.14:41	3.2.1.-:2	3.2.1.17:2	3.2.1.132:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	109	301	1.5e-22	0.5337837837837838

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
119349	GH18_chitinase-like	2.08e-09	114	279	18	179	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
214753	Glyco_18	5.30e-08	114	276	20	184	Glyco_18 domain.
395573	Glyco_hydro_18	4.51e-07	101	277	1	176	Glycosyl hydrolases family 18.
119365	GH18_chitinase	1.60e-06	114	276	20	209	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119362	GH18_3CO4_chitinase	5.14e-04	261	359	148	246	The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACF10394.1|GH18	7.89e-12	114	277	59	241
QKD57502.1|GH18	3.42e-11	114	277	54	237
AAP04616.1|GH18	1.08e-10	114	277	59	241
AAF19615.1|GH18	1.78e-10	114	277	50	232
QDJ94326.1|GH18	2.33e-10	114	277	23	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EPB_A	1.19e-10	114	277	58	240	Structure of Chitinase 42 from Trichoderma harzianum [Trichoderma harzianum]
4MNJ_A	2.96e-09	99	277	3	193	Crystal Structure of GH18 Chitinase from Cycad, Cycas revoluta [Cycas revoluta],4MNK_A Crystal Structure of GH18 Chitinase from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta],4R5E_A Chain A, Chitinase A [Cycas revoluta]
3WIJ_A	7.05e-09	99	277	3	193	Crystal structure of a plant class V chitinase mutant from Cycas revoluta in complex with (GlcNAc)3 [Cycas revoluta]
3G6L_A	1.12e-08	114	277	41	223	The crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea [Clonostachys rosea],3G6M_A crystal structure of a chitinase CrChi1 from the nematophagous fungus Clonostachys rosea in complex with a potent inhibitor caffeine [Clonostachys rosea]
4MNL_A	3.98e-08	99	277	3	193	Crystal Structure of GH18 Chitinase (G77W/E119Q mutant) from Cycas revoluta in complex with (GlcNAc)4 [Cycas revoluta],4MNM_A Crystal Structure of GH18 Chitinase (G77W/E119Q mutant) from Cycas revoluta in complex with (GlcNAc)4 [Cycas revoluta]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O14456|CHI1_METAN	6.10e-10	114	277	59	241	Endochitinase 1 OS=Metarhizium anisopliae OX=5530 GN=chit1 PE=1 SV=1
sp|A6N6J0|CHI46_TRIHA	1.47e-09	114	277	59	241	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
sp|P32470|CHI1_APHAL	1.93e-09	114	277	58	240	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|E9ERT9|CHI1_METRA	2.57e-09	114	277	59	241	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P48827|CHI42_TRIHA	3.42e-09	114	277	58	240	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000053	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000017950-p1.