CAZyme Information: EPrPVT00000017769-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000017769-p1
• CAZy Family: GH17
• CAZyme Description: Endo-1,4-beta-xylanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
349		38080.96	8.8587

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0240:33012-34131(+)

Full Sequence      

MLRAIAFLAVSYLAVAEGAITKASYTGKQGLDDYASKVGKYMGTATDLNPTDTYYTTELK
NGHEFGMVTPGNAMKWDSTEPSRNSFSFTKGDALVSVAQAAGHKVRCHALVWHQQVPSWV
QSLGKADLLSALKTHITKVMTHFGDNCYAWDVVNEALAEDGSYRQSFWYTKTGTEYITTA
FQTAAAVKKSLGLKTKLYYNDYNTDKVNAKSTGALKIAQLLQSKGIAIDGMGFQSHLTAG
QVASTADQVKNLNRFTAIGLDVAITELDVKVGTTSPTAAQQKQQKTDYQNTVAACKAVTK
CVGVTIWDFSDQYSWISNDSPLPFYQPSGKNTAVVRKTAYDGILYAWTH

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	33	327	4.3e-91	0.9405940594059405

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.04e-121	31	344	1	309	Glycosyl hydrolase family 10.
214750	Glyco_10	3.93e-102	74	343	1	263	Glycosyl hydrolase family 10.
226217	XynA	7.71e-77	57	327	50	330	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV63055.1|GH10	7.14e-148	13	347	14	350
AOV63054.1|GH10	2.18e-147	8	347	9	348
AOV63057.1|GH10	6.48e-132	8	347	9	353
AOV63056.1|GH10	2.46e-125	8	347	9	357
UIZ28775.1|GH10	1.67e-112	24	347	29	354

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JDT_A	8.07e-100	30	344	2	314	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
5XZO_A	1.70e-92	30	349	2	335	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6Q8M_A	1.71e-90	30	344	24	336	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUF_A	6.65e-84	31	333	5	304	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUB_A	9.41e-84	31	333	5	304	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5ZNB1|XYND_TALFU	5.12e-89	13	344	9	331	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|O60206|XLNA_AGABI	2.19e-86	26	348	14	332	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|B4XVN1|XYNA_STRSQ	4.05e-81	31	333	43	342	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	1.32e-77	26	343	89	402	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|Q8J1Y4|XYN5_MAGGR	1.92e-76	26	321	33	328	Endo-1,4-beta-xylanase 5 OS=Magnaporthe grisea OX=148305 GN=XYL5 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000260	0.999717	CS pos: 18-19. Pr: 0.9663

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000017769-p1.