CAZyme Information: EPrPVT00000017419-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000017419-p1
• CAZy Family: GH17
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
733		79620.90	6.1106

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0213:699-2900(-)

Full Sequence      

MRRLLCSLATAGIFLSCAGADDAWEVGNPAPPSNLVKNSSQLLSLCAPRNVDIPTGRPIP
TNAWWGNIVSCNDTNSSTTVWAQPLAVVVDSAGTGGGVYGFGVGYPYRTRFYGPASADGV
VAYYAHSARKELTISAVDFQTTVPTTRVVDWTDLGVRVQMRLPSSSSSLIATLVRGMAYV
TATFAGLVPRIVIEEPIQSINDVAATTGATITSSRFVVVTVTGKTWLVYAMSATGQSTTV
AITMESNSAFRTASAFNGVLRVTPVTDTTQAAAHDSYSSCIVTGGTATVDSNDAYSFQWK
TAGNCTKGVFNYALDHHTRTVTDASVTVVPGVSMGSTTHGMMKALVTQTSPPVWSFTEPD
TIPISFYPRTRATTDDMSSLGMLANLVADVQATWSIAVDGSYYFNGKQAQKYASLCLMAN
DPAIVAQDASVLKRCVSKLEAVIAPFLTNGWTYKLMYDTVMGGIVSSESFVTGDLGSDFG
NTVYNDHHYHYGYWVYAAAAINYLHPTWSRLSELNTMTRLLLRDVATPTSADPYFPKFRN
FDWFQGHSYSHGLTLLADGKDQESTSEDINFVYAMSLFGAATGHDRMREIGNLMTKVTAR
ATQTYFLMMNASDIHPASFRPHKATGILFDNKVEYATWFCGTVECIHGIQMLPVTPVTEF
ARSKPFVQEEWTSVLSSDDKVVSGDMTEPWLSLFYLNYARVDKQAALSMLQQCALDDGLS
RSWALYSASLFSQ

Enzyme Prediction     

No EC number prediction in EPrPVT00000017419-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	56	726	5.5e-169	0.9710610932475884

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	3.82e-148	386	725	14	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	4.09e-125	26	732	61	756	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.81e-38	48	368	4	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCA25009.1|GH81	1.90e-235	4	729	47	786
UIZ20868.1|GH81	1.90e-228	31	733	90	794
UIZ20872.1|GH81	3.81e-228	31	733	90	794
UIZ20875.1|GH81	3.81e-228	31	733	90	794
UIZ20873.1|GH81	1.53e-227	31	733	90	794

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	1.13e-87	48	726	30	713	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	1.87e-87	48	726	55	738	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.23e-83	48	726	30	713	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	6.34e-34	59	722	35	647	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	3.54e-17	485	719	439	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AZ24|ENG1_ARTBC	1.27e-81	18	732	189	904	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.02e-80	166	732	180	739	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q09850|ENG2_SCHPO	3.13e-79	58	729	34	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|P53753|ENG1_YEAST	1.70e-74	58	725	433	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q5AIR7|ENG1_CANAL	1.18e-72	30	729	436	1139	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000795	0.999181	CS pos: 16-17. Pr: 0.5626

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000017419-p1.