CAZyme Information: EPrPVT00000016886-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000016886-p1
• CAZy Family: PL3
• CAZyme Description: Cellulose synthase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1001		112910.93	7.9103

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0170:35743-38904(+)

Full Sequence      

MPPAKGDDEDYALYATPSAVDARAPGEAEIVRRGEGRPLGQQGYNDPQGPPEPAVGVSAA
VGVPDDDQKDNIITVHGYMHKQGKRGMKGPIHKSWKRRYFGKLLTVLSIIRTALEKSRIF
YFQSHLECRQYFTTRNPDLVVGAIELKDALQLRPCARLDLPHKGFEVITRRRVWVLCPES
DDEFRLWFEGVEAAIVACGSGNIIERKLPNVRKYYMKGITSYRVLYFLFLLMGLVELFGL
VFWFVVGVAPCDASNRTLPCADVYDGTPDDLSCSSDPMSGWFTPPDWYMTLAGVDDIVCF
HDPPIPQWVAFFALIVAELLSLFLGAFYYLGMWKPIDVLLCHFSEPAEETIDTLMACMNL
QYPPHLLQIYVLDDGYCSTKWTRGNPVPAIELNREILEKAGDLRQEIAQFMYDRVCDPNE
EMEVYAWRKLHSSANLPSASRPRVVNRADCAAGSFRDDYRYPGMPHVTYVGRVKPTLHYA
KAGNINNCLYNEGANGRXXXXVLLLNNDMQPHPKFILATLPFFFDDEDRQLRNKYTCSCT
GCNNVAKMCCASCKIAGVPEERISYCSKECFENAMHVQSDLHRRQVNGTLSKSGVCRKCG
KEQNSDVAVLHSYSDDVRDNAVGFVQTPQYFRDCIQLQMGDPLGHRNATFYDAIQTGQDG
YDCSSYAGTNVLLRREAIDSIAGIQYGTLTEDTYTGQRLLSMGWKAMYFRKDFEGEADER
IRLAEGLIPDTVAGAMSQRKRWAKGAFQTALMKKNNTKKVIDPEWKKPQVPIPKYRKPNN
MMRRVFYFNSTMFPLGSISVILLYYITLYFLYTGYAPIYVNGLRVLIALVPKLIVQGLIG
ALSTRGVENNDVVRSQEASYVYAFTNITAMLGAIVWKLTGKKSKWLNKREAKRGSLAELP
NVIVFAATGFGIIWALVRYIVSYYNRVYSHGDSMLTAAVLMGLFIVYNLGPSVRMSIQEY
FGWSYTSLMDQGNFMGSISIAIGLCFIALWVQVEKPYTSGT

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	4.20e-36	336	750	3	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
133057	CESA_NdvC_like	3.07e-16	619	748	111	230	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
236918	bcsA	6.52e-15	618	748	366	490	cellulose synthase catalytic subunit; Provisional
404513	Glyco_trans_2_3	1.04e-10	617	812	23	193	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.
224136	BcsA	2.14e-10	618	830	164	352	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UOI87916.1|GT2	0.0	1	996	6	1012
ABP96906.1|GT2	0.0	2	998	12	1012
AXF53808.1|GT2	0.0	9	998	15	1015
ABP96902.1|GT2|2.4.1.12	0.0	9	996	15	1013
UIZ24308.1|GT2	0.0	9	996	13	1010

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	7.76e-11	617	748	378	503	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	1.20e-22	465	748	584	763	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	1.11e-14	617	748	256	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|P19449|BCSA1_KOMXY	1.11e-14	617	748	254	379	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|Q93IN2|BCSA_SALTY	3.02e-10	617	834	378	571	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
sp|P37653|BCSA_ECOLI	3.96e-10	617	748	378	503	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000048	0.000001

TMHMM  Annotations     

Start	End
972	991
224	246
308	330
786	808
823	845
858	880
900	922
935	957