CAZyme Information: EPrPVT00000016840-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000016840-p1
• CAZy Family: GH16
• CAZyme Description: Endo alpha-1,4 polygalactosaminidase precusor

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
347	PvexDAOMBR484_SC0166|CGC1	36348.14	3.7556

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0166:36408-37540(-)

Full Sequence      

MRTASLMLALVATLGTSVTEAWWKPTPGTSYQIQLSGTLDLSYNVKMYDIDLFDTPASTI
ASLKEKGIKVVCYFSAGTYENWRPDKANYTDAMIGSSLPEWEGEYWVDTTNTDLRAILKA
RMELAKSKGCDGVDPDNVDGAFNDPGFDLTSDTQLDFNRFLADTAHSLDLTVGLKNDLAQ
VEDLVSSFDFAVNEQCVAYEECATLEPFIKANKPVFGIEYDGDKAAVCEEANERNFDTLN
SVGGEADASEANASNSAASEATLSESAASESASSESSASEVASSEANASESAASETASSE
ATGSESTASNSTANESAANEAAASGSTGSSSSGEASSTGSNLSPEQP

Enzyme Prediction     

No EC number prediction in EPrPVT00000016840-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH114	31	220	9.4e-76	0.9947368421052631

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397552	Glyco_hydro_114	2.20e-102	30	239	1	213	Glycoside-hydrolase family GH114. This family is recognized as a glycosyl-hydrolase family, number 114. It is endo-alpha-1,4-polygalactosaminidase, a rare enzyme. It is proposed to be TIM-barrel, the most common structure amongst the catalytic domains of glycosyl-hydrolases.
226386	COG3868	2.33e-31	8	220	37	266	Predicted glycosyl hydrolase, GH114 family [Carbohydrate transport and metabolism].
225219	COG2342	1.03e-07	53	243	57	274	Endo alpha-1,4 polygalactosaminidase, GH114 family (was erroneously annotated as Cys-tRNA synthetase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADO71463.1|GH114	6.86e-91	16	239	76	301
ADD68031.1|GH114	5.98e-84	15	239	23	247
CCU71188.1|GH114	3.48e-81	22	239	47	271
AHK16568.1|GH114	3.48e-81	22	239	47	271
AKU96720.1|GH114	7.22e-81	15	239	70	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6OJ1_A	2.53e-65	19	239	30	264	Crystal Structure of Aspergillus fumigatus Ega3 [Aspergillus fumigatus Af293]
6OJB_A	4.21e-65	19	239	47	281	Crystal Structure of Aspergillus fumigatus Ega3 complex with galactosamine [Aspergillus fumigatus Af293]

Swiss-Prot Hits     

EPrPVT00000016840-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000308	0.999690	CS pos: 21-22. Pr: 0.9684

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000016840-p1.