CAZyme Information: EPrPVT00000016223-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000016223-p1
• CAZy Family: GH1
• CAZyme Description: Endo-1,3(4)-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
696	PvexDAOMBR484_SC0127|CGC1	75682.65	5.0307

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0127:10-2097(-)

Full Sequence      

MSTVHRRPTAGSTHSVSESIPSSADPSSPADSLPPPQPDERSGSMALRVAAVVAVVSAVA
ASLSHAWYYSTDSQPSQAVSVGALRLPFSTDPPSETLFARNALGDLAPIVNVAPELLDKP
IPTNAWWGNLIHTTAADFATVANPVWANPYALKLPKANAPFGVQACYSHSYRQTAPEHDG
AIQYYLHGFRNDLTLSATEFGTTKPDYEVYEWSDLGVSVRTCASGTSNCMDSALVSGMAF
VSATYDGLMPRLQSDYAMSLQDCSIAGKYVLKLASNGQTWVVYTSDTSVSFAIDGTGTAL
VASGAYKGTVSVAVLPESGDPTVYDDYAGCVVRGATVSVDSRTSYSFNWATNGTTCESKG
LLHFALPHHLGVLSDSAIKKDAVVLHSTTRGQMVGIITTELKWTLAEHESDAEVGFYPTT
RPSATVVAQVNLFSTLQSDIAADWRLGTGSWYFNGKAYQKYASLCLMAADASVVGEDTSL
LVACIKKLEALIEPFLDNSLSPPLNYETTYSGIVSSMTFTNNDVNVDFGNGVYNDHHYHF
GYWVTASAMLKKLDPNWSRMSELETMVWTLLRDVANPSSDDPYFTTFRHFSWFLGHSYSH
GVTPMADGKDEESTSEDINFYYGMMLWGQVTGKQEVEDLGSLMLRLNARAIQTYFLMTSD
NAVHPAAFVKNHVTGIFFDNKAHYTTWFSAEKYCIH

Enzyme Prediction     

No EC number prediction in EPrPVT00000016223-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	113	696	8e-152	0.8488745980707395

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
227785	Acf2	9.17e-113	118	696	87	670	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
407548	Glyco_hydro81C	2.32e-111	436	696	18	270	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
397619	Glyco_hydro_81	2.34e-54	118	418	12	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	54	696	9	656
UIZ26440.1|GH81	0.0	54	696	9	656
UIZ26131.1|GH81	2.53e-258	87	696	15	630
UIZ26137.1|GH81	3.50e-255	70	696	104	740
UIZ26602.1|GH81	3.50e-255	70	696	104	740

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.62e-82	119	696	39	637	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	4.18e-82	119	696	64	662	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	3.60e-79	119	696	39	637	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.53e-29	117	695	31	576	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	7.10e-20	120	695	48	600	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	1.39e-80	120	694	34	615	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	3.08e-75	112	691	73	647	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|Q5AIR7|ENG1_CANAL	1.22e-71	96	690	439	1047	Endo-1,3(4)-beta-glucanase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ENG1 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	5.33e-69	120	691	225	808	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	2.24e-68	83	696	55	693	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999857	0.000137

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000016223-p1.