CAZyme Information: EPrPVT00000014713-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000014713-p1
• CAZy Family: AA3
• CAZyme Description: Exo-1,3-beta-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
859		96046.33	4.7669

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0052:21379-24352(+)

Full Sequence      

MPLINQASNSSSCRVAVIGAGIAGVTAANSLVSSGRFAPEDIRVLEAAGRIGGRVETCKF
SSDLPMNVEIGAAWIHGTQGNPFIALAKKFGIEWKEVSPRNPWLHPSSCSDFLVFNGADQ
LSEEAVQETWKWHETLLEKLQQLRTTAEGFEDGKSLTAVVEDMVADDRDIQALVNSDPNG
RKRLDMCVRLIETWMGLTSNELQVADNFAGTDLVGDDPGAHCIVPGGMERFIDGLAEPVK
DSIQTNACVSSIDYDDDKVVIELANGETVTAEFVVVTCSLGYLKSKKLQFHPELPVEKVD
AIDRSKMGQYMKVLLQFPSVFWPEDAKFIGQIDNPQPDSYIDGDDNRVYFPCFFNYYYAK
GAPVLEAQIVGEKAAHLSKHLTNDEIANAMYLQLRDMFGADTPKPVNHFITRWDQDKWAV
GAYSCFTVGNTDDDPDLVRQPVGKRVFFAGEATDYKYQGALQAAYLTGRQAADEIVAEAD
ELATAPNQIAKILEMADLQLRLRRGEIPCRGVNLGGWLVAEHWLSWDACIWDGVPGEIAN
QGEYATMNFLGHAEGDRRFEQHRRTWITENDLAEIKASGLNMVRVPVGFWIMGQDPTDVS
HKQEWAVFASGALQYLDVLVHEWCARHELAVLVDIHAAKGSQNGRDHSAAPTPGVKYWGD
YPENVDNTVILARFLADRYRSCPWFLGLGLLNEPEYPVNPAVVKDYYQRAYREIRATGND
CVLTIAPMLTEQCPPHLEDFLRSPEAFNVWVEWHPYFIWGYEGQSRDQVLHAVKCYGEQL
ARWSGCWLLVDEWSLGSPDSAFPAADRKRLKRFADAQLAAFQAAHAGWVFWTWRHSDDAH
GKPTGWSLRQLLRDGVMRV

Enzyme Prediction     

No EC number prediction in EPrPVT00000014713-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	560	838	2.9e-43	0.9711191335740073

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396255	Amino_oxidase	6.00e-66	22	475	1	445	Flavin containing amine oxidoreductase. This family consists of various amine oxidases, including maze polyamine oxidase (PAO) and various flavin containing monoamine oxidases (MAO). The aligned region includes the flavin binding site of these enzymes. The family also contains phytoene dehydrogenases and related enzymes. In vertebrates MAO plays an important role regulating the intracellular levels of amines via there oxidation; these include various neurotransmitters, neurotoxins and trace amines. In lower eukaryotes such as aspergillus and in bacteria the main role of amine oxidases is to provide a source of ammonium. PAOs in plants, bacteria and protozoa oxidase spermidine and spermine to an aminobutyral, diaminopropane and hydrogen peroxide and are involved in the catabolism of polyamines. Other members of this family include tryptophan 2-monooxygenase, putrescine oxidase, corticosteroid binding proteins and antibacterial glycoproteins.
177909	PLN02268	5.57e-58	15	476	3	431	probable polyamine oxidase
178144	PLN02529	9.82e-55	1	488	151	607	lysine-specific histone demethylase 1
215362	PLN02676	1.05e-54	7	478	21	472	polyamine oxidase
215187	PLN02328	2.82e-53	15	485	241	685	lysine-specific histone demethylase 1 homolog

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAM18484.1|GH5	2.60e-201	498	859	9	370
UIZ29723.1|GH5	4.97e-197	501	859	4	362
CCA15861.1|GH5	2.91e-155	499	859	13	374
CCA15900.1|GH5	1.53e-129	498	859	102	454
UIZ29004.1|GH5	8.32e-108	488	854	27	399

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1B37_A	2.32e-35	14	476	6	455	A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase [Zea mays],1B37_B A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase [Zea mays],1B37_C A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase [Zea mays],1B5Q_A A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase [Zea mays],1B5Q_B A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase [Zea mays],1B5Q_C A 30 Angstrom U-Shaped Catalytic Tunnel In The Crystal Structure Of Polyamine Oxidase [Zea mays],1H81_A STRUCTURE OF POLYAMINE OXIDASE IN THE REDUCED STATE [Zea mays],1H81_B STRUCTURE OF POLYAMINE OXIDASE IN THE REDUCED STATE [Zea mays],1H81_C STRUCTURE OF POLYAMINE OXIDASE IN THE REDUCED STATE [Zea mays],1H82_A Structure Of Polyamine Oxidase In Complex With Guazatine [Zea mays],1H82_B Structure Of Polyamine Oxidase In Complex With Guazatine [Zea mays],1H82_C Structure Of Polyamine Oxidase In Complex With Guazatine [Zea mays],1H83_A Structure Of Polyamine Oxidase In Complex With 1,8- Diaminooctane [Zea mays],1H83_B Structure Of Polyamine Oxidase In Complex With 1,8- Diaminooctane [Zea mays],1H83_C Structure Of Polyamine Oxidase In Complex With 1,8- Diaminooctane [Zea mays],1H84_A COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 4.6 [Zea mays],1H84_B COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 4.6 [Zea mays],1H84_C COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 4.6 [Zea mays],1H86_A COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 7.0 [Zea mays],1H86_B COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 7.0 [Zea mays],1H86_C COVALENT ADDUCT BETWEEN POLYAMINE OXIDASE AND N1ethylN11((cycloheptyl)methyl)4,8diazaundecane at pH 7.0 [Zea mays]
3KPF_A	1.51e-34	14	476	6	455	Chain A, Polyamine oxidase [Zea mays],3KPF_B Chain B, Polyamine oxidase [Zea mays],3KU9_A Chain A, Polyamine oxidase [Zea mays],3KU9_B Chain B, Polyamine oxidase [Zea mays],3L1R_A Chain A, Polyamine oxidase [Zea mays],3L1R_B Chain B, Polyamine oxidase [Zea mays]
5LAE_A	6.46e-34	14	476	6	483	Crystal structure of murine N1-acetylpolyamine oxidase [Mus musculus],5LFO_A Crystal structure of murine N1-acetylpolyamine oxidase in complex with N1-acetylspermine [Mus musculus],5LGB_A Crystal structure of murine N1-acetylpolyamine oxidase in complex with MDL72527 [Mus musculus],5MBX_A Crystal structure of reduced murine N1-acetylpolyamine oxidase in complex with N1-acetylspermine [Mus musculus]
4GU0_A	5.38e-32	15	477	339	775	Crystal structure of LSD2 with H3 [Homo sapiens],4GU0_B Crystal structure of LSD2 with H3 [Homo sapiens],4GU0_C Crystal structure of LSD2 with H3 [Homo sapiens],4GU0_D Crystal structure of LSD2 with H3 [Homo sapiens],4GUR_A Crystal structure of LSD2-NPAC with H3 in space group P21 [Homo sapiens],4GUS_A Crystal structure of LSD2-NPAC with H3 in space group P3221 [Homo sapiens],4GUT_A Crystal structure of LSD2-NPAC [Homo sapiens],4GUU_A Crystal structure of LSD2-NPAC with tranylcypromine [Homo sapiens],4HSU_A Crystal structure of LSD2-NPAC with H3(1-26)in space group P21 [Homo sapiens],6R1U_K Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 2 [Homo sapiens],6R25_K Structure of LSD2/NPAC-linker/nucleosome core particle complex: Class 3 [Homo sapiens]
4GU1_A	5.52e-32	15	477	347	783	Crystal structure of LSD2 [Homo sapiens],4GU1_B Crystal structure of LSD2 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VXV7|LDL1_ARATH	9.27e-44	14	489	267	721	Lysine-specific histone demethylase 1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=LDL1 PE=1 SV=1
sp|Q7XUR2|LDL3_ORYSJ	1.04e-42	15	480	200	638	Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560300 PE=2 SV=2
sp|Q9LID0|LDL2_ARATH	2.95e-41	15	482	162	600	Lysine-specific histone demethylase 1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=LDL2 PE=1 SV=1
sp|Q01H90|LDL3_ORYSI	5.88e-41	15	480	200	638	Lysine-specific histone demethylase 1 homolog 3 OS=Oryza sativa subsp. indica OX=39946 GN=B0103C08-B0602B01.13 PE=3 SV=1
sp|Q6Z690|LDL1_ORYSJ	1.62e-39	15	476	273	713	Lysine-specific histone demethylase 1 homolog 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0755200 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999007	0.001028

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000014713-p1.