CAZyme Information: EPrPVT00000014058-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000014058-p1
• CAZy Family: PL1
• CAZyme Description: Cellulose synthase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1035		117276.91	7.1970

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0026:69138-72245(-)

Full Sequence      

MSNWQNASGLQGQGIPEHDPYSNTPNAGVYQQYHQPIEAESGLAASNGEMAQALFKRVES
SDDTQKAISELTKADDHEDIGRISVHGWMHKQGTRKFKGPVAKSWRKRYFALEGNKIYYF
HDFVDCRKYFNSRNAELVVGAVDLRDAFKLEQSERLDLPARGIAIHTRHRVWLVCPETDS
DFSMWFDALEFTVMSAGSGNVVKRDLPNVRVYEMKGRGSYRFWYVIFVIAALVELAGIVL
WFPLGVAPCDQKYKEYTCDELQQLYADTLQCGSKPFNGMWNPPDWYWWSAGMSSINCFYE
PTIPHWVSYFLFYLAEFISISLGFLYYLGMWKPVRRGARYLRDFEPHFPPEKWPTVDILL
CHYAEPAEDTIATLEKILNLDYPPHLFHVWICDDGYCKSKWEPGAAVPKVSVNRGVIEDA
GDVRHEVAQFMYERVCESEDLEVEEFRKQHTSVKMPTNANPRLVARADCAVGSVRDDYVY
HGFPKVTFCGRIKPPVHHSKAGNINNVLYNEGACGRYAIILDNDMKPHEMFIQAVLPFFF
DSPKNSKITRCCAPGCGDIGKICCALCQAAGVPEAQVSYCSKDCYNASGHTKSSLHRRQT
QNTMSERMVCSDCGNKITQSKGMCKKCMRRADTSRRNSIQVVGISADDYSDHVSVNQVGY
VQTPQYFEDCLQLRLGDPCGHRNSTFFDSAQTGMDGYECASFAGTNAIFRREALDSVCGI
QYGSLTEDAFTGKMMIDKGWKGLYFRKDLEGEESDRIRLAEGAVPETVAAALAQRKRWAK
GNFQIFLRNKHSLVDPEWAPPQVELPPPRKYSRFMRWVFFMNLTVYPIGSFPALFFFYCT
GFFLYSGQAPIYTSGLRLLMALVPKIVAQSILSALSNRTVDNDDVLRSQQTWFSYAFVHV
LGVFETFYWKITGKEATWANTGALGGNSPMEIPNLLVFMAMAFGMMWRVVQYFCGYNNAA
TTHGTPLLFASLFLGGFIVSQLGPMVRMSLQTYFGWSHKSLTDHGNLVGSFSLAIVLVII
CLWVYVETPNHQVFG

Enzyme Prediction     

EC	2.4.1.12:3

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	1.73e-33	354	786	1	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	2.97e-14	657	786	369	492	cellulose synthase catalytic subunit; Provisional
224136	BcsA	1.17e-13	656	901	166	401	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
133057	CESA_NdvC_like	2.06e-12	657	788	113	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
281541	Cellulose_synt	2.93e-11	722	938	414	612	Cellulose synthase. Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals. The genes that synthesize cellulose in higher plants differ greatly from the well-characterized genes found in Acetobacter and Agrobacterium sp. More correctly designated as 'cellulose synthase catalytic subunits', plant cellulose synthase (CesA) proteins are integral membrane proteins, approximately 1,000 amino acids in length. There are a number of highly conserved residues, including several motifs shown to be necessary for processive glycosyltransferase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXF53810.1|GT2	0.0	15	1035	12	1019
ABP96905.1|GT2|2.4.1.12	0.0	15	1035	12	1019
ABP96913.1|GT2	0.0	15	1035	12	1019
ABP96909.1|GT2	0.0	25	1035	13	1022
AEC45571.1|GT2	0.0	15	1035	12	1019

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	2.73e-11	657	874	382	578	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
7D5K_A	5.97e-06	716	1027	730	1024	Chain A, Cellulose synthase [Gossypium hirsutum],7D5K_B Chain B, Cellulose synthase [Gossypium hirsutum],7D5K_C Chain C, Cellulose synthase [Gossypium hirsutum]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	1.49e-21	484	900	584	880	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|P19449|BCSA1_KOMXY	1.45e-11	653	786	254	381	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsA PE=1 SV=1
sp|O82859|BCSA2_KOMSB	1.45e-11	653	786	256	383	Cellulose synthase catalytic subunit [UDP-forming] OS=Komagataeibacter sucrofermentans (strain ATCC 700178 / DSM 15973 / CECT 7291 / JCM 9730 / LMG 18788 / BPR 2001) OX=1307942 GN=bcsA PE=3 SV=1
sp|Q9WX61|BCSA3_KOMXY	1.89e-11	653	786	254	381	Cellulose synthase 1 catalytic subunit [UDP-forming] OS=Komagataeibacter xylinus OX=28448 GN=bcsAI PE=3 SV=1
sp|Q8X5L7|BCSA_ECO57	1.39e-10	657	874	382	578	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

Start	End
222	244
309	331
823	845
892	911
932	949
964	986
1007	1026