CAZyme Information: EPrPVT00000013988-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000013988-p1
• CAZy Family: PL4
• CAZyme Description: Glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
658		73788.24	6.6360

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0024:52949-55234(+)

Full Sequence      

MRRTAALFASLVTFLVLATSVNGEETAVEGEGGMAALARELKDDEGAFATILYDHGDESE
ALLLATRVLMRSIRNSETRFRRIVIVPQDGLQPHSEALLRQDDPQIEIVRTKIPNVFRHS
QLTDHRTQLLHMRNKLVIWDDPVLSTLKRVVYLDGENLVLRNLDEIFACRQFCAVDNGQS
VVYANSLLVISPDSLAARNLYSDAIDTFMITGREYNYVGIMQGFVPGLFEAFEESPLFFF
DDSDVDVDTRDAVVHRLPFYYSINHMVFYERMNWDLYKCKDKNLSTGAIPGPLLSFKYSG
ATIKPWFWLPYTYFQVFWHWEQVRGELQEDHLGFFLSKLVSLTVIFAFAWSTYTMLCLKL
HTEPSGRPRRLSSFGLPAPGNAQPLSMDIFNSRVVRRACQISCSILYAVSSTPLLSSILI
VLVLTWVSVYSVPGTMHPSYAGKLWLYLDNLLLLTVLLVYAVAHIFRTAQWTKDNVPSSA
VLLLDSLVRCVKRLPMLVAAQVVFLYFVGRTDLFMNPVLRPVTTFLLFAIVLLIQVGRSR
SMSTNSMAVDGGVTASRDEVMETVYELSRLLNTGLDRETLAILMALVQKGVNPEVLAAVV
KDLRKDAAEQRAAMSATSVSTAGNSIAATPAATDRESPRVRQFTGKQPLASDELQVSQ

Enzyme Prediction     

No EC number prediction in EPrPVT00000013988-p1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133018	GT8_Glycogenin	2.86e-22	47	327	2	240	Glycogenin belongs the GT 8 family and initiates the biosynthesis of glycogen. Glycogenin initiates the biosynthesis of glycogen by incorporating glucose residues through a self-glucosylation reaction at a Tyr residue, and then acts as substrate for chain elongation by glycogen synthase and branching enzyme. It contains a conserved DxD motif and an N-terminal beta-alpha-beta Rossmann-like fold that are common to the nucleotide-binding domains of most glycosyltransferases. The DxD motif is essential for coordination of the catalytic divalent cation, most commonly Mn2+. Glycogenin can be classified as a retaining glycosyltransferase, based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. It is placed in glycosyltransferase family 8 which includes lipopolysaccharide glucose and galactose transferases and galactinol synthases.
403672	MOZART1	1.69e-16	559	603	1	45	Mitotic-spindle organizing gamma-tubulin ring associated. The name MOZART is derived from letters of 'mitotic-spindle organizing proteins associated with a ring of gamma-tubulin'. This family operates as part of the gamma-tubulin ring complex, gamma-TuRC, one of the complexes necessary for chromosome segregation. This complex is located at centrosomes and mediates the formation of bipolar spindles in mitosis; it consists of six subunits. However, unlike the other four known subunits, this family does not carry the conserved 'Spc97-Spc98' GCP domain, so the TUBCGP nomenclature cannot be used for it. MOZART1 is required for gamma-TuRC recruitment to centrosomes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ28025.1|GT8	4.75e-248	52	535	1	501
CCA23792.1|GT8	1.42e-158	44	535	49	568
CCA16211.1|GT8	1.74e-20	47	331	48	327
QCD81290.1|GT8	2.49e-20	42	326	44	300
BAT75850.1|GT8	1.06e-19	42	326	44	300

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6X0U_A	1.79e-10	559	618	23	82	Structure of MZT1/GCP3-NHD and MZT1/GCP6-NHD in the gamma-TuRC lumenal bridge [Homo sapiens],6X0U_C Structure of MZT1/GCP3-NHD and MZT1/GCP6-NHD in the gamma-TuRC lumenal bridge [Homo sapiens],7AS4_5 Chain 5, Mitotic-spindle organizing protein 1 [Homo sapiens],7AS4_6 Chain 6, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ0_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ0_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ1_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ1_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ2_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ2_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ2_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ3_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ3_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ3_o Chain o, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ4_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ4_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ4_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ4_o Chain o, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ5_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ5_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ5_g Chain g, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ5_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ5_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ5_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ6_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ6_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ6_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ6_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ6_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ7_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ7_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ7_g Chain g, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ7_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ7_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ7_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ8_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ8_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ8_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ8_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ8_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ9_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ9_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ9_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ9_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJ9_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJA_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJA_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJA_g Chain g, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJA_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJA_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJA_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJB_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJB_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJB_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJB_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJB_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJC_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJC_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJC_g Chain g, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJC_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJC_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJC_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJD_b Chain b, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJD_d Chain d, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJD_g Chain g, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJD_i Chain i, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJD_k Chain k, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJD_m Chain m, Mitotic-spindle organizing protein 1 [Homo sapiens],7QJD_o Chain o, Mitotic-spindle organizing protein 1 [Homo sapiens]
6L81_B	1.94e-10	559	618	26	85	Crystal structure of Homo sapiens GCP5 N-terminus and Mozart1 [Homo sapiens],6L81_D Crystal structure of Homo sapiens GCP5 N-terminus and Mozart1 [Homo sapiens]
6M33_B	1.94e-10	559	618	26	85	Chain B, Mitotic-spindle organizing protein 1 [Homo sapiens]
6L7R_B	9.20e-07	555	604	14	63	Chain B, Mozart1 [Thermochaetoides thermophila DSM 1495],6L82_B Chain B, Mozart1 [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8VZP6|GUX8_ARATH	6.25e-18	8	324	9	313	Putative glucuronosyltransferase PGSIP8 OS=Arabidopsis thaliana OX=3702 GN=PGSIP8 PE=2 SV=1
sp|F4JMI5|GUX7_ARATH	1.92e-17	1	331	3	308	Putative glucuronosyltransferase PGSIP7 OS=Arabidopsis thaliana OX=3702 GN=PGSIP7 PE=3 SV=1
sp|Q8GWB7|GUX6_ARATH	7.55e-13	47	333	32	284	Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana OX=3702 GN=IPUT1 PE=1 SV=1
sp|B5FXZ4|MZT1_TAEGU	5.17e-10	559	605	13	59	Mitotic-spindle organizing protein 1 OS=Taeniopygia guttata OX=59729 GN=mzt1 PE=3 SV=1
sp|Q0VFD6|MZT1_XENTR	7.07e-10	547	605	1	59	Mitotic-spindle organizing protein 1 OS=Xenopus tropicalis OX=8364 GN=mzt1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000239	0.999736	CS pos: 23-24. Pr: 0.9804

TMHMM  Annotations     

Start	End
339	361
407	429
444	466
486	508
518	537