CAZyme Information: EPrPVT00000013934-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000013934-p1
• CAZy Family: AA17
• CAZyme Description: Alpha

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1299	PvexDAOMBR484_SC0022|CGC1	142202.68	6.5263

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0022:27750-31720(-)

Full Sequence      

MTSPRNEFYVSQRAADYEPSRVDTLSLEEQEILANIQDLQLQLMQLRAAEEEDSSDEESP
PASSKPGAADNQLIVVSNTLPILLERVPNTGRWKATKTTGGLDKLMCLTGVRTDLNFLWV
GWVGQHIPKHEHESVRRLLLQHNCLPVFTSSDVATRHSTFSSDVLWPLFHYVSEPVALTF
SSGSSDNAAKRFNKQDWRAYESANESFADAIAEIYNEGDSVWIHDYHLMLLPSLLRQRIP
LCHIGWFLHTPFPTYDVYARLPVRTLLLSGVLQADLAGFQTFDYERHFLTTCQRLLGVEC
SHKGIRSALSDHRDHFTSIGVFPIGISVEPFAKGASSTQTLLRVNELQNKFGSKRIILGI
DRLDNIKGIPHKLLAMEVLLDRFPEWQHNVVLIQIGISSRGTTTLDNITSRSVRTTADTK
YSSSPERNSYTGGLSSPHHSKTASTPSNDQAQAANSSAHPPTGGAGGSGAAGSSAPTPGQ
GAGAADTQQHHPLEMSSHTYRSQLAHVNQLVGRINGQYGTLDYAPIHFIHQETTSHEELC
ALYDLADVCLVTSTRDGMNLVSHEFVVCQQHFMRKKEERLKASRAATRAQSPQPQLTEAV
TNALADSNAPASSPEPPANRHALLSRGASSSSLNNVLSPTKILTEWEGEEGGPGVLILSE
FAGSSQSLSGAMVINPWNTEDLAVCVNQALSMCRTERELRQQKLYRYVSSNTATAWSMQF
LSDLGDAVAQNRQPTGQLPKLDRDEIVKSYRQAKNRVIILDYDRTLTPQHSLLPLAAVGP
NFKSLLDALSSDDRNTVFILSARERKFLETWLNGVRVGVAAEDGYFYRMNLQNPLEAWKT
MSKFHYDAASARVGVLSGNNPPLSATMSVSGGGASLDSSSYFESHQSRRSVSLGSAPSYS
SYGGHTPTVRSGAGGSGSVLGSDSSFEAEDTSWKDLVLPLMLMFTDRTPGSYLEDKESSL
TWHYGDSDPEFGEWQAKDMQIILERQLIGTALDVYKGHQSVSVEHEGCTKTRVIEAILKH
LSLPQQIAKKKDCEVDFVLCVCDDVTDDQMFQTLNTLVEESKERHEERQKRAADDKLTAV
RARRHSIAHTGTNSAKSADAKQHSDGSGKLSGASSAKGAKKSMNARPRSSSGGGDLLTRQ
RRPRSPLKVQGKVAGKPKKRSGQQHQPPNTDSSDDEDDDDELHDKPNRMHDDNKVSFSRL
QNVPVRLAEDVALFTVVVGADVKHSGGHGAWSFAVESLSDVRKVLKDFAEESRHGSGLPV
PDSSTPPTALASESEAAPAKAAAQEEMSPTTVSLPADSS

Enzyme Prediction     

EC	2.4.1.15:146

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT20	70	413	6.4e-104	0.6842105263157895

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
184712	PRK14501	5.64e-175	73	1054	3	690	putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional
340820	GT20_TPS	3.07e-161	72	724	1	462	trehalose-6-phosphate synthase. Trehalose-6-Phosphate Synthase (TPS, EC 2.4.1.15) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor. It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain.
395781	Glyco_transf_20	1.10e-152	73	724	3	468	Glycosyltransferase family 20. Members of this family belong to glycosyl transferase family 20. OtsA (Trehalose-6-phosphate synthase) is homologous to regions in the subunits of yeast trehalose-6-phosphate synthase/phosphate complex,.
215555	PLN03063	5.10e-148	72	1041	12	706	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional
215556	PLN03064	8.72e-146	72	1122	95	881	alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ29831.1|GT20	0.0	1	1278	23	1233
CCA23376.1|GT20	0.0	2	1252	478	1629
CCA20339.1|GT20	7.40e-174	20	1051	34	795
CCA16456.1|GT20	5.28e-172	25	1051	127	878
QOX06485.1|GT20	7.47e-160	67	1058	71	781

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JBI_A	1.07e-104	72	724	1	462	Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBI_B Structure of Tps1 apo structure [Pyricularia oryzae 70-15],6JBR_A Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_B Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_D Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_F Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_H Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_K Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_M Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBR_O Tps1/UDP/T6P complex [Pyricularia oryzae 70-15],6JBW_A Structure of Tps1/UDP complex [Pyricularia oryzae 70-15],6JBW_B Structure of Tps1/UDP complex [Pyricularia oryzae 70-15]
5HVM_A	3.51e-104	72	724	13	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVM_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase A in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HVO_A	1.15e-103	70	724	10	474	Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_B Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_C Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293],5HVO_D Structure of Aspergillus fumigatus trehalose-6-phosphate synthase B in complex with UDP and validoxylamine A [Aspergillus fumigatus Af293]
5HUT_A	2.96e-103	72	724	5	467	Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUT_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP-glucose [Candida albicans SC5314],5HUU_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HUU_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and glucose-6-phosphate [Candida albicans SC5314],5HVL_A Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314],5HVL_B Structure of Candida albicans trehalose-6-phosphate synthase in complex with UDP and validoxylamine A [Candida albicans SC5314]
5HUV_A	1.50e-102	72	724	5	467	Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314],5HUV_B Structure of Candida albicans trehalose-6-phosphate synthase E341R/E346R in complex with UDP-glucose [Candida albicans SC5314]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q54K57|TPSA_DICDI	1.31e-138	72	1003	17	659	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum OX=44689 GN=tpsA PE=2 SV=1
sp|Q00764|TPS1_YEAST	4.23e-112	68	724	13	480	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TPS1 PE=1 SV=2
sp|Q07158|TPS1_KLULA	6.57e-112	73	724	18	480	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=TPS1 PE=1 SV=1
sp|Q9FZ57|TPS2_ARATH	1.01e-111	72	1040	13	707	Probable alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Arabidopsis thaliana OX=3702 GN=TPS2 PE=3 SV=1
sp|Q9SYM4|TPS1_ARATH	1.64e-111	72	1041	93	794	Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Arabidopsis thaliana OX=3702 GN=TPS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000013934-p1.