CAZyme Information: EPrPVT00000013604-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000013604-p1
• CAZy Family: AA16|AA17
• CAZyme Description: GPI mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
542	PvexDAOMBR484_SC0012|CGC1	61683.63	6.7668

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0012:103168-105588(+)

Full Sequence      

MWEELPTSRGFWVAVLAFRAWNALFVRTSFNPDEYWQSTEVAHRMVFGYGHLTWEWQDDA
QIRGYAHPAIFALFYKLLQLSGLDSRWAVAYGPRLLQAVVSFLNDYFLYKLASAYFDRKS
AKWALLCNLCSWFIFYAMVRPFSNTIETLCTTAALAYWPWSFQDAAAKKTDGDSALQATA
GNRTLALALAALGVLFRPTNVVVWVFPGVMLLLGVQDRLRLLLLTVFPIALATIAAMLVI
DRAGYGEWTFVPLNFVRFNVLEGKDKLYGEHPWNWYFSQGFPSIVGTALPPAIAGYLTVP
STKKDLGYIVLWSLFIYSNAPHKVSPDDIERYALTEFRFVLPLLPPTLVYAGYCLRNLEN
RLYVQFRERTQRNLLFAAVFSLIVPNVAASYYLSRTHQRAPADVMDFLSERIQASIHFWT
PCHATPYYSYLHQNVSMWFPDCSPKNRERPEGCESHQLERDPVQFLSNKYQFAAAATHEG
GSSSEELPTYVVTYSTIAAKIGNVLDTGNFVEEASFFHSQVAGDADASDAVDRMLVYRRD
MD

Enzyme Prediction     

No EC number prediction in EPrPVT00000013604-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT22	13	432	1.1e-104	0.9922879177377892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215437	PLN02816	4.10e-109	7	531	37	538	mannosyltransferase
281842	Glyco_transf_22	3.54e-96	11	432	2	414	Alg9-like mannosyltransferase family. Members of this family are mannosyltransferase enzymes. At least some members are localized in endoplasmic reticulum and involved in GPI anchor biosynthesis.
395827	DegT_DnrJ_EryC1	0.002	355	440	255	329	DegT/DnrJ/EryC1/StrS aminotransferase family. The members of this family are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions. The family includes StsA, StsC and StsS. The aminotransferase activity was demonstrated for purified StsC protein as the L-glutamine:scyllo-inosose aminotransferase EC:2.6.1.50, which catalyzes the first amino transfer in the biosynthesis of the streptidine subunit of streptomycin.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26527.1|GT22	5.15e-132	1	301	1	284
CAG1850842.1|GT22	8.26e-121	2	531	40	536
VDD19328.1|GT22	2.60e-116	7	531	40	546
CAB4105495.1|GT22	4.11e-115	3	531	27	523
BBN14164.1|GT22	1.01e-114	5	519	46	557

PDB Hits     

EPrPVT00000013604-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q94A15|APTG1_ARATH	4.80e-115	4	531	34	538	Mannosyltransferase APTG1 OS=Arabidopsis thaliana OX=3702 GN=APTG1 PE=2 SV=1
sp|Q9JJQ0|PIGB_MOUSE	3.51e-103	16	519	57	515	GPI mannosyltransferase 3 OS=Mus musculus OX=10090 GN=Pigb PE=2 SV=2
sp|Q1LZA0|PIGB_BOVIN	1.05e-101	15	519	57	516	GPI mannosyltransferase 3 OS=Bos taurus OX=9913 GN=PIGB PE=2 SV=1
sp|Q92521|PIGB_HUMAN	1.01e-98	16	521	68	528	GPI mannosyltransferase 3 OS=Homo sapiens OX=9606 GN=PIGB PE=1 SV=1
sp|Q4V7R2|PIGB_XENLA	1.52e-94	13	521	53	514	GPI mannosyltransferase 3 OS=Xenopus laevis OX=8355 GN=pigb PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998266	0.001754

TMHMM  Annotations     

Start	End
193	215
222	240
275	297
374	393