CAZyme Information: EPrPVT00000013417-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000013417-p1
• CAZy Family: AA1
• CAZyme Description: Glycerophosphodiesterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
106	PvexDAOMBR484_SC0007|CGC1	11282.78	4.4000

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0007:106118-106503(-)

Full Sequence      

MATDALTVEFRVRLLERQAVDASAAVFVLGSAPELGAWDVEQAVPLTATEGDRELWTASV
ALAPKTGAVEYKYLVKSGPTLDVQSWESIPGNRTLTAVAHTTNVAL

Enzyme Prediction     

No EC number prediction in EPrPVT00000013417-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM20	8	101	5.4e-19	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215006	CBM_2	1.50e-17	26	96	18	85	Starch binding domain.
119437	CBM20	5.39e-16	26	96	16	83	The family 20 carbohydrate-binding module (CBM20), also known as the starch-binding domain, is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
395557	CBM_20	7.92e-15	26	96	17	84	Starch binding domain.
99891	CBM20_DSP	2.87e-12	25	104	15	89	Dual-specificity phosphatase (DSP), N-terminal CBM20 (carbohydrate-binding module, family 20) domain. This CBM20 domain is located at the N-terminus of a protein tyrosine phosphatase of unknown function found in slime molds and ciliated protozoans. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.
99888	CBM20_Prei4	3.15e-12	8	88	3	85	Prei4, N-terminal CBM20 (carbohydrate-binding module, family 20) domain. Preimplantation protein 4 (Prei4) is a protein of unknown function that is expressed during mouse preimplantation embryogenesis. In addition to the N-terminal CBM20 domain, Prei4 contains a C-terminal glycerophosphoryl diester phosphodiesterase (GDPD) domain. The CBM20 domain is found in a large number of starch degrading enzymes including alpha-amylase, beta-amylase, glucoamylase, and CGTase (cyclodextrin glucanotransferase). CBM20 is also present in proteins that have a regulatory role in starch metabolism in plants (e.g. alpha-amylase) or glycogen metabolism in mammals (e.g. laforin). CBM20 folds as an antiparallel beta-barrel structure with two starch binding sites. These two sites are thought to differ functionally with site 1 acting as the initial starch recognition site and site 2 involved in the specific recognition of appropriate regions of starch.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYA14910.1|CBM20	8.07e-12	3	98	38	124
APY84412.1|CBM20	8.07e-12	3	98	38	124
QUI29482.1|CBM20	8.07e-12	3	98	38	124
AIR96195.1|CBM20	1.59e-10	2	96	37	122
BCJ47306.1|CBM20	5.04e-10	26	94	66	132

PDB Hits     

EPrPVT00000013417-p1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0DN29|AMYG_ARTBC	5.86e-06	26	93	526	591	Glucoamylase ARB_02327-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02327-1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000042	0.000003

TMHMM  Annotations     

There is no transmembrane helices in EPrPVT00000013417-p1.