CAZyme Information: EPrPVT00000013413-p1

Basic Information

• Species: Phytopythium vexans
• Lineage: Oomycota; NA; ; Pythiaceae; Phytopythium; Phytopythium vexans
• CAZyme ID: EPrPVT00000013413-p1
• CAZy Family: AA1
• CAZyme Description: Cell 5A endo-1,4-betaglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567	PvexDAOMBR484_SC0007|CGC2	63533.10	5.1616

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_PvexansDAOMBR484	11991	1223560	34	11957

• Gene Location: location=PvexDAOMBR484_SC0007:96363-98163(-)

Full Sequence      

MRSHSGSSHRDIVAISTEESKTDPLVKYRGRLRRWPGVVLLVLMVLISISLILLAGRRHH
STFLVRLEAYKERAYGKKSITGGADGSDGIADLDDGEIGNPVKYPPSECAMPDYQSKQGK
IYAMAANGTEVPISIKGVNWFGMETYELSVVGLTLSTQRSNTTASIDCEADRRSSLGFGT
MLLLEQQRLPLYHRPTNTSRLGQYHIASYLSDNKFNAVRLPIMVDHLLKNTPPTKGMLNT
FSNQAVSAKDYLSMLKSIIQVLQFRRIGVLISMHTLIDGDTGGLWYNDAISEDDFLSAID
ILTSNLCSSDYWNVMGIDVKNEPYKAQWGSGPAAKDFRLGAARITERMLEGCPNWMGFVE
GLNYRSHNLTIDGDHYEYNDWYGGGLQDVKEHPIEMTTPNKIVWAPHYYTSAVYVQDYFY
GGGTIDWETRELDNFVELDDETLKLRVSATMLDMFGYLMDEQPQYALLLGEFGGLYARDE
HPKKTIQRTVDDTIAVMVENGYTGGFAWSLNPESKYQYCSADKGGLVATFEEGLLELDWL
TTNVKYLSALAAMDALPDLRRLPCFAL

Enzyme Prediction     

No EC number prediction in EPrPVT00000013413-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	203	514	5.2e-125	0.9011627906976745

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	6.33e-14	209	514	81	363	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	1.96e-11	212	514	35	272	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABL75349.1|GH5_20	3.55e-183	27	565	137	628
ABC87090.1|GH5_20	3.78e-174	10	565	118	628
ABK59037.1|GH5_20	3.78e-174	10	565	118	628
ABG80555.1|GH5_20	1.78e-173	28	565	143	633
ABG80554.1|GH5_20	1.78e-173	28	565	143	633

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W6M_A	3.05e-37	114	554	8	377	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3VVG_A	4.19e-37	114	554	8	377	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.29e-36	114	555	41	411	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.29e-36	114	555	41	411	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHO_A	4.50e-36	114	555	41	411	Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_B Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHO_C Crystal analysis of the complex structure, Y299F-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P54583|GUN1_ACIC1	8.29e-23	106	543	38	381	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P23548|GUN_PAEPO	3.32e-22	215	543	91	371	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P50400|GUND_CELFI	1.50e-18	206	546	89	406	Endoglucanase D OS=Cellulomonas fimi OX=1708 GN=cenD PE=3 SV=1
sp|P10474|GUNB_CALSA	1.76e-17	210	424	677	906	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1
sp|P27033|GUNC_CELJU	7.06e-06	313	514	493	707	Endoglucanase C OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=celC PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000007	0.000029

TMHMM  Annotations     

Start	End
37	56