CAZyme Information: EPrPRT00000025439-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000025439-p1
• CAZy Family: GT71
• CAZyme Description: Glycoside hydrolase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
306		32673.76	8.0066

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC05572:166-1193(+)

Full Sequence      

MFFPALKALSTAALLACASSVAHAAGSPEPLCSLPTASLVQAAQQYPTLTTAINEVLKNS
IAIWYTDNEAASSLQSKLSQLLSHCSSSTRMTIVVYGLPNKDCEAGYSNLGSNKNANDYR
NFIQTLANAVGQRKVLYELEPDAVGLVANGGCAVQNNYTANIANAVKQLSTVGRLKGITL
NSDNFRPTADMVKSCTNFQNAYGSTKLNCVIDTSRNYNNNPPSTEWCNARFGGIGRLPTA
STGYSNIDYFIWIKPAGESDGTCDGSDRSPDAMKGPVAGAFFKEGFISLWNNGIFVKERG
FKPISG

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	40	171	1.7e-19	0.48299319727891155

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	5.83e-32	47	266	2	290	Glycosyl hydrolases family 6.
227616	CelA1	2.58e-10	85	292	180	438	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	3.88e-77	14	304	7	322
UIZ23641.1|GH6	5.95e-74	29	306	26	334
AIG55947.1|GH6	1.04e-73	31	299	19	304
AIG55776.1|CBM1|GH6	1.44e-73	42	302	33	306
AIG55493.1|GH6	3.79e-72	42	302	33	307

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JX5_A	5.15e-20	70	292	48	317	GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_A GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102]
1TML_A	5.16e-18	93	268	70	273	CRYSTAL STRUCTURE OF THE CATALYTIC DOMAIN OF A THERMOPHILIC ENDOCELLULASE [Thermobifida fusca],2BOD_X Catalytic domain of endo-1,4-glucanase Cel6A from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta-cellobioside [Thermobifida fusca]
2BOE_X	8.86e-17	93	268	70	273	Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca [Thermobifida fusca],2BOF_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with cellotetrose [Thermobifida fusca],2BOG_X Catalytic domain of endo-1,4-glucanase Cel6A mutant Y73S from Thermobifida fusca in complex with methyl cellobiosyl-4-thio-beta- cellobioside [Thermobifida fusca]
4I5R_A	9.88e-15	94	292	79	352	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A [Humicola insolens]
4I5U_A	1.34e-14	94	292	79	352	Crystal structure of a fungal chimeric cellobiohydrolase Cel6A [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P26414|GUNA_THEBI	8.83e-18	93	261	104	301	Endoglucanase A OS=Thermobispora bispora OX=2006 GN=celA PE=3 SV=1
sp|P07984|GUNA_CELFI	2.89e-17	93	292	238	446	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|P26222|GUN2_THEFU	5.14e-17	6	268	6	304	Endoglucanase E-2 OS=Thermobifida fusca OX=2021 GN=celB PE=1 SV=2
sp|P49075|GUX3_AGABI	5.09e-14	47	292	117	433	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	1.63e-13	93	282	106	349	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000689	0.999302	CS pos: 16-17. Pr: 0.4269

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000025439-p1.