CAZyme Information: EPrPRT00000025431-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000025431-p1
• CAZy Family: GT71
• CAZyme Description: Endo-1,4-beta-xylanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
302		34343.65	5.4396

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC05550:241-1538(-)

Full Sequence      

MGTATNSADVTVNDAPYLKELDNAADWGFLTPTNAMKWESTEPTQNEFHTQLYYNDYNTD
RINAKSTGALNNIVKFLQNQSIEINGMGLQAHLTAGQVASVDDQIANMKRFTDLGLNVAI
TELDVKVKTKTPSKELQKQQTEDYEKTIKACKKLKGCLGVTVWDFSDEWSWINDFSQDTP
SPFYQPGGRNTTVVRKMAYDGIVRGWETDTRSFSLSVRTREEPTYIAVYLNTTEYCILLL
MCTEANRAYSIVPSLRWSQCAGQQRNNAFARVNYLADILCSSFLLRSYYYYYYCTKPLAG
FI

Enzyme Prediction     

EC	3.2.1.8:31

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	50	186	4.1e-35	0.42574257425742573

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395262	Glyco_hydro_10	1.13e-40	1	203	12	309	Glycosyl hydrolase family 10.
214750	Glyco_10	8.25e-37	49	202	122	263	Glycosyl hydrolase family 10.
226217	XynA	9.54e-21	49	186	186	330	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AOV63054.1|GH10	1.26e-49	50	206	196	348
AOV63055.1|GH10	2.27e-49	1	224	43	368
ACS96449.1|GH10|3.2.1.8	3.71e-34	35	212	244	423
AQX83207.1|GH10	4.69e-34	51	206	198	347
CAB05886.1|GH10|3.2.1.8	1.49e-32	49	206	182	331

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XZO_A	3.55e-36	35	204	160	331	Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZO_B Chain B, Beta-xylanase [Bispora sp. MEY-1],5XZU_A Chain A, Beta-xylanase [Bispora sp. MEY-1],5XZU_B Chain B, Beta-xylanase [Bispora sp. MEY-1]
6JDT_A	6.00e-30	2	205	16	316	Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDT_B Crystal structure of GH10 family xylanase XynAF1 from Aspergillus fumigatus Z5 [Aspergillus fumigatus Z5],6JDY_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDY_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 120 minutes [Aspergillus fumigatus Z5],6JDZ_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JDZ_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 20 minutes [Aspergillus fumigatus Z5],6JE0_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE0_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 30 minutes [Aspergillus fumigatus Z5],6JE1_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE1_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 40 minutes [Aspergillus fumigatus Z5],6JE2_A Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5],6JE2_B Ligand complex structure of GH10 family xylanase XynAF1, soaking for 80 minutes [Aspergillus fumigatus Z5]
6Q8M_A	8.43e-28	2	205	38	338	GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8M_B GH10 endo-xylanase [Aspergillus aculeatus ATCC 16872],6Q8N_A GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872],6Q8N_B GH10 endo-xylanase in complex with xylobiose epoxide inhibitor [Aspergillus aculeatus ATCC 16872]
3WUB_A	3.91e-26	51	202	165	308	The wild type crystal structure of b-1,4-Xylanase (XynAS9) from Streptomyces sp. 9 [Streptomyces sp.],3WUE_A The wild type crystal structure of b-1,4-Xylanase (XynAS9) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]
3WUF_A	3.91e-26	51	202	165	308	The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) from Streptomyces sp. 9 [Streptomyces sp.],3WUG_A The mutant crystal structure of b-1,4-Xylanase (XynAS9_V43P/G44E) with xylobiose from Streptomyces sp. 9 [Streptomyces sp.]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O60206|XLNA_AGABI	2.64e-33	49	206	182	331	Endo-1,4-beta-xylanase OS=Agaricus bisporus OX=5341 GN=xlnA PE=2 SV=1
sp|Q5ZNB1|XYND_TALFU	1.86e-31	51	212	185	340	Endo-1,4-beta-xylanase D OS=Talaromyces funiculosus OX=28572 GN=xynD PE=1 SV=1
sp|Q9HEZ1|XYNA_PHACH	1.03e-24	51	206	259	406	Endo-1,4-beta-xylanase A OS=Phanerodontia chrysosporium OX=2822231 GN=xynA PE=1 SV=1
sp|B4XVN1|XYNA_STRSQ	1.24e-24	51	202	203	346	Endo-1,4-beta-xylanase A OS=Streptomyces sp. OX=1931 GN=xynAS9 PE=1 SV=1
sp|Q2PGV8|XYN2_AURPU	7.28e-23	50	172	197	325	Endo-1,4-beta-xylanase 2 OS=Aureobasidium pullulans OX=5580 GN=xynII PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999944	0.000116

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000025431-p1.