CAZyme Information: EPrPRT00000023815-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000023815-p1
• CAZy Family: GT31|GT10
• CAZyme Description: Glycoside hydrolase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
317		33987.53	7.3629

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC03199:2097-3108(-)

Full Sequence      

MVFSIMKSLCAATLLACASSVLPQVKATGSPDPLCSLPTASLVAAAQQYPTLTSAINTVL
NNSIAMWYTDNEAASSLETKLNQLVSHCPENSRLMLVVYGLPNKDCEAGYSNLGSNKNAK
DYKNFIEKLTKVVGKRKVLYVLEPDAVGLVANGGCAVKEGYTDNVREASAIKIANAVKSL
STVGRLKGIVLNSDNFRPTADMATLCTTFQNAYNSTALNCVVDTSRNYNNNPPSTEWCNS
RFGGIGRPPTDKTGYSNLDYLIWIKPAGESDGTCDGSDRSPDAMVGPPAGQFFKEGFISL
WNNGYYVQEKGFPAIAP

Enzyme Prediction     

No EC number prediction in EPrPRT00000023815-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH6	168	276	2.9e-26	0.3877551020408163
GH6	43	167	5.7e-19	0.45918367346938777

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396075	Glyco_hydro_6	4.70e-31	50	277	2	290	Glycosyl hydrolases family 6.
227616	CelA1	3.20e-10	219	305	332	440	Cellulase/cellobiase CelA1 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ23635.1|GH6	4.03e-80	30	311	20	318
AIG55947.1|GH6	6.65e-75	34	310	19	304
UIZ23641.1|GH6	6.76e-73	16	315	8	332
AIG55776.1|CBM1|GH6	5.19e-71	55	307	43	300
AIG55792.1|GH6	1.05e-69	40	315	28	310

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JX5_A	2.40e-17	65	303	44	317	GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],5JX5_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_A GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_B GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_C GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102],6IDW_D GH6 Orpinomyces sp. Y102 enzyme [Orpinomyces sp. Y102]
1UP3_A	1.01e-15	95	303	72	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with METHYL-CELLOBIOSYL-4-DEOXY-4-THIO-BETA-D-CELLOBIOSIDE at 1.6 angstrom [Mycobacterium tuberculosis H37Rv]
1UP0_A	1.01e-15	95	303	72	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with cellobiose at 1.75 angstrom [Mycobacterium tuberculosis H37Rv]
1UOZ_A	1.26e-15	95	303	93	312	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with thiocellopentaose at 1.1 angstrom [Mycobacterium tuberculosis H37Rv]
1UP2_A	2.56e-15	95	303	72	291	Structure of the endoglucanase Cel6 from Mycobacterium tuberculosis in complex with glucose-isofagomine at 1.9 angstrom [Mycobacterium tuberculosis H37Rv]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P07984|GUNA_CELFI	3.82e-16	95	303	237	446	Endoglucanase A OS=Cellulomonas fimi OX=1708 GN=cenA PE=1 SV=1
sp|Q7SIG5|GUN6_HUMIN	2.89e-14	90	300	77	337	Endoglucanase-6B OS=Humicola insolens OX=34413 GN=cel6B PE=1 SV=1
sp|B2ADA5|GH6D_PODAN	5.75e-14	96	283	106	345	Probable exoglucanase GH6D OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=GH6D PE=3 SV=1
sp|B2AE04|CEL6C_PODAN	3.08e-13	50	303	74	392	1,4-beta-D-glucan cellobiohydrolase CEL6C OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) OX=515849 GN=CEL6C PE=1 SV=1
sp|P49075|GUX3_AGABI	1.53e-12	90	303	154	433	Exoglucanase 3 OS=Agaricus bisporus OX=5341 GN=cel3 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000276	0.999708	CS pos: 27-28. Pr: 0.9656

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000023815-p1.