CAZyme Information: EPrPRT00000023511-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000023511-p1
• CAZy Family: GT22
• CAZyme Description: UDP-glucose:glycoprotein glucosyltransferase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1340		151058.84	5.4126

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC02923:23-4045(-)

Full Sequence      

MRDDEDEDEEGSVDEEIDGLVFSNLVESYPSIAGELKTFRDQLVKQHDQADQEIKAWHLQ
DIGISAAREILDSKHPLKRLRILSQNFPKHARKLAFSRKPLSDDLREEIDLRRNEAVQTG
LLNRFLLNGIMVDSMQRSFNIFDFVGTLKKEWSIAKKLAALPLPADEREAMLANIRESKS
EDTAARIRVRGPVDGVAPLYLNNIETDYQTSQWPPSVAHLRRPAWNLIFIRKNMYEYVVA
FDPTSQQGRIALTQMSFLRMRSAPLQWGVLISTKDLVDAKTTAERDALVAHYKRAEMSDT
ATGWHFAKLLVMAKDQDKPDEDGLTGRFVKEFVEGVADESTEPTLLAMVDCYLDATGGSF
ARAANREKTLTLLRGDKYDEDVMAMTEYIGQKHLPFESALFNGVLKKDLDLQGDIMVHFG
RDQGLYQQMANADELEDDMDLVAELLGAQDAYPAYFSLFSESKSAEPGPGSSSFEAPNHL
FANDENGLLEKLIATQVKFVHQSNTLSQPKKQTLLFSANLNDPVHAAHTQRAFKAVQEDL
GTVMRVGVIHRLSDEGGVGDIAAFIVEAIGHSDVEAHVQLATESLNCAAKGKTVEATKSK
LMGLIDKIDGWKSDAVLSTIRGELANAGPLRLSKTLFDSLVQQNRALDAAQPRLKIGQES
LAQLYLNGFRIDLPEQPISDEDIAALISYDMKRRSHAIAKAFIKRSVTYTAEEASQRSMN
IVKASAIIDEYRKVERITPIDHNDSSVSIKLDGDESLRVVAYIDPLTEAAQLMSSLLFML
HGQLNATIEVLVLPASDYSEFPLQRFYRYVFDKKTSLGSSVTFRNLPIKPILTMKIDTPE
AWNVQIYRTVEDLDNLRVDPDDAADVRAIKTASFRLESLLVYGQCYDKTFDQYSPPNGLQ
LVLERDMGNRRLHRDTLVMKNYGYFQLQATPGVWNLHLARGRAVELYEIVEPRTDKRLTS
SDIVVSSFTSKLEQLLVEKRPGMEMEVLLKSGDSSDSKSSSDDVEAIAADAGVLGSAWNS
VMSMFGKKKANVATKNGTSPAKDVVPTGGANAGRKGETIHVFSLATGHLYERFIKIMMLS
VLKRTENPVTFWLLENFLSPDFKDSIPALREKFGMDIRLVTYKWPNWLRQQTQKQRIIWG
YKILFLDVLFPLGVQKIIYVDADQVVRADLKELWEMDLQGAPYGYTPFCDSRNVGFQFWR
QGYWKDHLRGRPYHISALYVVDLALFRQMAAGDILRSIYDQLSADPNSLSNLDQDLPNYA
QHQIKIHSLPQEWLWCESWCSDDSKVTAKTIDLCNNPKHKEPKLDMAKRVISGELFPESW
LQLDQEIKDAEKAYVPLSVE

Enzyme Prediction     

EC	2.4.1.-:29

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT24	1059	1304	1.3e-122	0.9959677419354839

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
408203	Glyco_transf_24	0.0	1059	1329	1	267	Glucosyltransferase 24. This is the catalytic domain found in UDP-glucose:glycoprotein glucosyltransferase (UGGT). This domain belongs to glucosyltransferase 24 family (GT24) A-type domain. The GT domain displays the expected glycosyltransferase type A (GT-A) fold.
133054	GT8_HUGT1_C_like	6.53e-164	1059	1304	1	248	The C-terminal domain of HUGT1-like is highly homologous to the GT 8 family. C-terminal domain of glycoprotein glucosyltransferase (UGT). UGT is a large glycoprotein whose C-terminus contains the catalytic activity. This catalytic C-terminal domain is highly homologous to Glycosyltransferase Family 8 (GT 8) and contains the DXD motif that coordinates donor sugar binding, characteristic for Family 8 glycosyltransferases. GT 8 proteins are retaining enzymes based on the relative anomeric stereochemistry of the substrate and product in the reaction catalyzed. The non-catalytic N-terminal portion of the human UTG1 (HUGT1) has been shown to monitor the protein folding status and activate its glucosyltransferase activity.
132996	Glyco_transf_8	5.43e-58	1059	1299	1	243	Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. GT-8 comprises enzymes with a number of known activities: lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, glycogenin glucosyltransferase, and N-acetylglucosaminyltransferase. GT-8 enzymes contains a conserved DXD motif which is essential in the coordination of a catalytic divalent cation, most commonly Mn2+.
399437	UDP-g_GGTase	2.35e-25	883	989	2	108	UDP-glucose:Glycoprotein Glucosyltransferase. UDP-g_GGTase is an important, central component of the QC system in the ER for checking that glycoproteins are folded correctly. This QC prevents incorrectly folded glycoproteins from leaving the ER.
408201	Thioredoxin_14	1.37e-23	194	442	9	231	Thioredoxin-like domain. This is the third out of four TRXL(thioredoxin-like) domains found in UDP-glucose:glycoprotein glucosyltransferase (UGGT).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20865.1|GT24	0.0	14	1334	294	1660
CCA14500.1|GT24	0.0	40	1335	349	1666
AIG55512.1|GT24	0.0	47	1334	307	1515
AIG56125.1|GT24	0.0	57	1334	318	1505
BBN16825.1|GT24	3.39e-185	34	1328	328	1595

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TS2_A	1.58e-134	753	1329	649	1212	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_C Chain C, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TS2_D Chain D, UDP-glucose-glycoprotein glucosyltransferase-like protein,UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5MU1_A	4.11e-133	62	1329	273	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5MZO_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],5N2J_B Chain B, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495],6TRF_A Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
6TRT_A	4.11e-133	62	1329	273	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5NV4_A	1.07e-132	753	1329	883	1446	Chain A, UDP-glucose-glycoprotein glucosyltransferase-like protein [Thermochaetoides thermophila DSM 1495]
5H18_A	6.67e-115	1059	1329	5	271	Crystal structure of catalytic domain of UGGT (UDP-glucose-bound form) from Thermomyces dupontii [Thermomyces dupontii],5Y7F_A Crystal structure of catalytic domain of UGGT (UDP-bound form) from Thermomyces dupontii [Thermomyces dupontii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6P5E4|UGGG1_MOUSE	2.02e-180	15	1334	280	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Uggt1 PE=1 SV=4
sp|Q9JLA3|UGGG1_RAT	7.58e-180	15	1334	280	1527	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Uggt1 PE=1 SV=2
sp|Q9NYU2|UGGG1_HUMAN	3.20e-173	15	1331	280	1524	UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1 PE=1 SV=3
sp|Q0WL80|UGGG_ARATH	3.53e-171	15	1328	290	1566	UDP-glucose:glycoprotein glucosyltransferase OS=Arabidopsis thaliana OX=3702 GN=UGGT PE=1 SV=1
sp|Q09332|UGGG_DROME	3.89e-171	8	1328	261	1505	UDP-glucose:glycoprotein glucosyltransferase OS=Drosophila melanogaster OX=7227 GN=Uggt PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

There is no transmembrane helices in EPrPRT00000023511-p1.