CAZyme Information: EPrPRT00000023200-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000023200-p1
• CAZy Family: GT20
• CAZyme Description: Cellulose synthase 2.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674		76058.60	7.8070

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC02689:2180-4485(-)

Full Sequence      

MLDDGYCKAKWSKGSNVPVIELNKGILETAGDLRQEVAQFMYDRVCDPNEDMEVYQWRKL
HSSANLPSPSRPKVVNRADCAAGSFRDDYRYPGLPHVTFIGRVKPDTHYSKAECFENAMH
VQSDVHRRQPETHYSKAGNINNCLYNEGANGRYLVILDTDMQPHAKFVLATLPFFFEDPD
RVDKTKYTCCCTGCNNVAKMCCASCKLAAVPEERISYCSKECFENAMHVQSDVHRRQVNG
TLNDDKNNSKKEFRCVGCSTKLGKSGVCKKCNRQNTEEDDGMASLHRYSDDVKDNAVAFV
QTPQYFRDCIQLQIGDPMGHRNATFYDAIQTGQDGYENSSFAGTNAMFRREALDSIGGIQ
YGSLTEDCYTGQQLCAMGWKALYFRKDFEGEPSERIRLAEGLIPESVAGSLAQRKRWAKG
NFQIALMNKKKNYMDPEWKKPEVQVPTYNKPSGFMRRVFYVNGTMYPLGSISAVLFFYVT
LYFLFSGYAPIYMSGLRLLIALVPKLLVQGMLSALSNRTVENNDVVRSQETWFAYAFTNC
SAVLEALWWKLTGKEPRWFNTGGAQRGSTAELPNVAIFLGNVVGVAWAVVRFFAGYNSEQ
MSHGASLLFASTLMGLFIAYKLGPSVRMSIQEYFGWSYQSLMDEGNFMGFVSIAFGILFI
AFWVFVEKPSSNPF

Enzyme Prediction     

EC	2.4.1.12:3

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	285	499	1.8e-17	0.8730964467005076

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
133043	CESA_CelA_like	5.93e-35	125	425	63	234	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
236918	bcsA	2.12e-18	293	499	366	554	cellulose synthase catalytic subunit; Provisional
133057	CESA_NdvC_like	1.44e-13	285	427	102	234	NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase. Bradyrhizobium japonicum synthesizes periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans during growth under hypoosmotic conditions. Two genes (ndvB, ndvC) are involved in the beta-(1, 3), beta-(1,6)-glucan synthesis. The ndvC mutant strain resulted in synthesis of altered cyclic beta-glucans composed almost entirely of beta-(1, 3)-glycosyl linkages. The periplasmic cyclic beta-(1,3),beta-(1,6)-D-glucans function for osmoregulation. The ndvC mutation also affects the ability of the bacteria to establish a successful symbiotic interaction with host plant. Thus, the beta-glucans may function as suppressors of a host defense response.
224136	BcsA	2.81e-13	294	569	165	439	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
404513	Glyco_trans_2_3	3.98e-13	284	427	15	148	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEZ51038.1|GT2	0.0	1	674	378	1025
UIZ24309.1|GT2	0.0	1	674	371	1019
ABP96907.1|GT2	0.0	3	674	382	1026
ABP96911.1|GT2	0.0	1	674	380	1028
ADD84671.1|GT2	0.0	3	674	382	1026

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7LBY_A	7.74e-17	292	632	378	692	Chain A, Cellulose synthase catalytic subunit [UDP-forming] [Escherichia coli K-12]
5EJ1_A	8.78e-17	292	487	252	425	Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	9.51e-17	292	487	264	437	Chain A, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	9.52e-17	292	487	265	438	Chain A, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9U720|DCSA_DICDI	5.69e-22	288	658	642	1046	Cellulose synthase catalytic subunit A [UDP-forming] OS=Dictyostelium discoideum OX=44689 GN=dcsA PE=1 SV=1
sp|Q8X5L7|BCSA_ECO57	3.94e-16	292	632	378	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli O157:H7 OX=83334 GN=bcsA PE=3 SV=2
sp|P37653|BCSA_ECOLI	3.94e-16	292	632	378	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Escherichia coli (strain K12) OX=83333 GN=bcsA PE=1 SV=3
sp|Q93IN2|BCSA_SALTY	2.73e-15	292	632	378	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsA PE=3 SV=1
sp|Q8Z291|BCSA_SALTI	6.24e-15	292	632	378	692	Cellulose synthase catalytic subunit [UDP-forming] OS=Salmonella typhi OX=90370 GN=bcsA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000069	0.000000

TMHMM  Annotations     

Start	End
463	485
572	594
604	626
647	666