CAZyme Information: EPrPRT00000022524-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000022524-p1
• CAZy Family: GT105
• CAZyme Description: Cell 5A endo-1,4-betaglucanase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
569		63207.35	6.0620

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC02233:1699-5375(-)

Full Sequence      

MSLLKGIIKTLQFRHISVMLSMHTLTFEDNGKLWYNAKITEDKFLESIDILTKNLCTNEY
WNVIGIDLKNEPYDGTWGDGGPKDFRAGAKRIADRMLKGCPNWMGFVEGVNAQHTITIDG
QEFGYYDWFGGGLHGAKTKGLEFNIPNKVVWAPHYYTPAVFPQYYLYGGVEHFWVHAQLS
MAHHSDAGEPTPTGSAYSDFADGDHGPTYRNSNMLPRTPDSHGGRGGASGIDVFVRGSLQ
DRHIEAVPPTTNAKIERARDYKGRIRTWPGLMFIMFLLGGCGFLATYYGMKARNSSENRS
SAYEKALFNSTTITGGGTKLGVGTDDADDDGFRHIGVLLSMHTLTNDDIGDLWFNDAFPE
EKFLEAIDVLTKELCTNEYWNVMGLDLKNEPAKGTWGDGGPKDFRAGAKRIADRMLKGCP
NWMGFVEGVNAQHSITIDGQDDDKLRGRIKATMDDMFGFLASETGPALLLGEFGGLYAED
KHPMKTTKRCTDFTIEIIKKPGWAGGFVWSLNPESGYGYNPVDKPGHFTEGVLNTDWLSA
NPAFIKALQAMDDMEGLQPFPCFRKTKST

Enzyme Prediction     

No EC number prediction in EPrPRT00000022524-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	1	170	2.1e-70	0.4941860465116279

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225344	BglC	1.96e-06	4	174	118	292	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
395098	Cellulase	8.48e-05	1	163	64	202	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ24396.1|GH5_20	2.53e-103	2	563	301	1220
ABC87091.1|GH5_20	1.05e-102	211	569	55	605
ABK59038.1|GH5_20	1.05e-102	211	569	55	605
ABL75349.1|GH5_20	8.64e-98	227	569	107	634
ABG80555.1|GH5_20	2.01e-91	2	568	328	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VVG_A	7.49e-22	1	165	100	275	The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_B The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3VVG_C The Crystal Structure of Cellulase-Inhibitor Complex. [Pyrococcus horikoshii OT3],3W6L_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6L_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM1_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
3W6M_A	7.49e-22	1	165	100	275	Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],3W6M_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_A Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_B Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3],4DM2_C Contribution of disulfide bond toward thermostability in hyperthermostable endocellulase [Pyrococcus horikoshii OT3]
2ZUM_A	1.64e-21	1	165	133	308	Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_A Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_B Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],2ZUN_C Functional Analysis of Hyperthermophilic Endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3AXX_A	1.64e-21	1	165	133	308	Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_B Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3],3AXX_C Functional analysis of hyperthermophilic endocellulase from the Archaeon Pyrococcus horikoshii [Pyrococcus horikoshii OT3]
3QHM_A	1.64e-21	1	165	133	308	Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_B Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii],3QHM_C Crystal analysis of the complex structure, E342A-cellotetraose, of endocellulase from pyrococcus horikoshii [Pyrococcus horikoshii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P23548|GUN_PAEPO	2.48e-16	14	163	139	282	Endoglucanase OS=Paenibacillus polymyxa OX=1406 PE=3 SV=2
sp|P54583|GUN1_ACIC1	7.08e-16	16	163	150	288	Endoglucanase E1 OS=Acidothermus cellulolyticus (strain ATCC 43068 / DSM 8971 / 11B) OX=351607 GN=Acel_0614 PE=1 SV=1
sp|P19487|GUNA_XANCP	1.61e-13	333	539	127	356	Major extracellular endoglucanase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) OX=190485 GN=engXCA PE=1 SV=2
sp|P10474|GUNB_CALSA	2.07e-12	7	169	727	904	Endoglucanase/exoglucanase B OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=celB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000050	0.000000

TMHMM  Annotations     

Start	End
267	289