CAZyme Information: EPrPRT00000022387-p1

Basic Information

• Species: Pythium arrhenomanes
• Lineage: Oomycota; NA; ; Pythiaceae; Pythium; Pythium arrhenomanes
• CAZyme ID: EPrPRT00000022387-p1
• CAZy Family: GH81|GH81
• CAZyme Description: Choline dehydrogenase.

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
589		64052.94	7.5246

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_ParrhenomanesATCC12531	13857	1223556	52	13805

• Gene Location: location=ParrATCC12531_SC02153:2491-4866(+)

Full Sequence      

MARSTERTPLLVERPSGGANWIARAVAIVRANRMAVAGALGSMLLVVMALVIHYASSASV
VATKESPQEFDTIVIGGGPAGSVVSKLLSDDPWRRVLLIEAGDATHVELGGTNRINSTSN
TKNLTSFDVPFYWTNVANTPSLHWDYPDVNVAKALGGCGIHNAMLYVRALPSDLSRWNLK
DWTWEKALQIYMDMESFDGPNVSYHGRTGTVRTSPPPLDSLSEQFLQACEDAGIPRTVDF
NAPSGRHGAGVYHFNTRDGIRESAARRFLGPMLKQQRKNFKLLLNTHVKRADGTLQTIHL
SSKGHVVLTAGAINTPKVLMLSGLGHGDDLNKLGLPVQKHLPRVGMNLQDHPVLAMTYES
PEAGALDIERELNKYFLATQNDATNATSFGMMGSAGISAGAFLIPPGATLPEIQLTFFPR
KSEPHVSNSSELTHDPQILITVALLHPSARNRIVLTTKDDKKYTPRIMSEVPDQEAEHLR
TDDVRKLAWGVSVVREVTNALDILQWVPTAVFRNSHWVGSAAMGNSSDTAVVDSRLRVFG
VRKLRVADASVIPTIPNGNVHSSVLMVASHAAELIRADEEAAEGSEKLF

Enzyme Prediction     

No EC number prediction in EPrPRT00000022387-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	68	577	1.6e-88	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	2.04e-74	69	582	7	540	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	7.10e-69	68	576	4	532	choline dehydrogenase; Validated
366272	GMC_oxred_N	1.13e-25	152	353	24	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
398739	GMC_oxred_C	7.00e-22	447	571	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
215420	PLN02785	6.80e-11	54	567	40	568	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ22502.1|AA3_2	3.31e-232	70	581	83	645
QWC20507.1|AA3_2	6.94e-51	68	576	4	525
BDA51473.1|AA3	1.50e-47	58	575	38	600
ALC48843.1|AA3_2	1.31e-46	64	576	89	654
CAB3230510.1|AA3_2	1.32e-45	69	579	24	559

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NNE_A	2.01e-43	66	577	10	528	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	5.17e-43	66	577	10	528	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]
2JBV_A	5.17e-43	66	577	10	528	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
6YS2_AAA	1.50e-42	68	575	6	560	Chain AAA, Fatty acid Photodecarboxylase [Chlorella variabilis]
5NCC_A	1.83e-42	60	575	11	576	Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_B Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_C Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_D Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_E Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis],5NCC_F Structure of Fatty acid Photodecarboxylase in complex with FAD and palmitic acid [Chlorella variabilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q988C9|4PADH_RHILO	1.75e-45	68	580	5	538	4-pyridoxate dehydrogenase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=padh1 PE=1 SV=1
sp|Q9WWW2|ALKJ_PSEPU	2.55e-44	70	575	2	527	Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida OX=303 GN=alkJ PE=3 SV=1
sp|Q8NE62|CHDH_HUMAN	6.31e-44	62	576	33	572	Choline dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=CHDH PE=1 SV=2
sp|Q6UPE0|CHDH_RAT	4.41e-43	56	576	32	577	Choline dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Chdh PE=1 SV=1
sp|Q47944|SDH_GLUOY	6.02e-43	70	578	5	530	L-sorbose 1-dehydrogenase OS=Gluconobacter oxydans OX=442 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000000	0.000023

TMHMM  Annotations     

Start	End
34	56